
<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
	<id>https://nesgwiki.chem.buffalo.edu/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Prossi</id>
	<title>NESG Wiki - User contributions [en]</title>
	<link rel="self" type="application/atom+xml" href="https://nesgwiki.chem.buffalo.edu/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Prossi"/>
	<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php/Special:Contributions/Prossi"/>
	<updated>2026-04-08T19:07:11Z</updated>
	<subtitle>User contributions</subtitle>
	<generator>MediaWiki 1.38.2</generator>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Homodimer_Structure_Calculation_with_Symmetry_Constraints&amp;diff=3300</id>
		<title>Homodimer Structure Calculation with Symmetry Constraints</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Homodimer_Structure_Calculation_with_Symmetry_Constraints&amp;diff=3300"/>
		<updated>2009-12-15T21:22:11Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
'''IMPORTANT DISCLAIMER:'''&amp;amp;nbsp;A number of NESG&amp;amp;nbsp;NMR groups are currently beta-testing sites for CYANA-3.0 and the information in this page is intended for use by the licensed members of the NESG consortium, other beta testers, and is to be used in accordance to the program licensing agreement. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The following page describes the setup and analysis of an automated structure determination run for symmertic homodimers starting from NOE peaklists in the framework of CYANA-3.0.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;Results from CYANA&amp;amp;nbsp;should always be accompanied by energy refinement in CNS or NIH-XPLOR.&amp;amp;nbsp; Further information about the program and publication references can be found in the [http://www.cyana.org/wiki/index.php/Main_Page CYANA WIKI]&amp;amp;nbsp;page. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Automated Homodimer Structure Calculation Setup &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The structure calculation with automated noesy assignments and intermolecular restraints follows the canonical CYANA&amp;amp;nbsp;recipe.&amp;amp;nbsp; Simple annealing calculations starting from a set of constraints that include RDC are easily derived by simplifying the scripts below and following the demo scripts. The program requires a sequence file (name.seq), a proton assignment list (name.prot), a noesy peaklist set (name.peaks), a CALC.cya script and an init.cya script.&amp;amp;nbsp;&amp;amp;nbsp; &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
An helpful script called '''DIMERIZE''', to be run from within CYANA, can be used to symmetrize various files such as the proton (.prot), angle and NOE constraint files:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;!/bin/sh&lt;br /&gt;
&lt;br /&gt;
# Chemical shift list&lt;br /&gt;
cp RpR324.prot RpR324d.prot&lt;br /&gt;
awk 'NF&amp;amp;gt;=5 { printf(&amp;quot;%6d%8.3f%8.3f&amp;amp;nbsp;%-5s%4d\n&amp;quot;,$1+1000,$2,$3,$4,$5+200) }' $* RpR324.prot &amp;amp;gt;&amp;amp;gt; RpR324d.prot&lt;br /&gt;
&lt;br /&gt;
# Additional distance constraints&lt;br /&gt;
echo &amp;quot;&lt;br /&gt;
read upl D5.upl&lt;br /&gt;
read lol D5.lol&lt;br /&gt;
molecules symmetrize&lt;br /&gt;
write upl D5dimer.upl&lt;br /&gt;
write lol D5dimer.lol&lt;br /&gt;
quit&amp;quot; | cyana32&lt;br /&gt;
&lt;br /&gt;
# angle constraints&lt;br /&gt;
echo &amp;quot;&lt;br /&gt;
read dihe.aco&lt;br /&gt;
shift +200&lt;br /&gt;
writeaco t.aco&lt;br /&gt;
quit&amp;quot; | ancoma&lt;br /&gt;
cat dihe.aco t.aco &amp;amp;gt; dihed.aco&lt;br /&gt;
rm -f t.aco&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
==== '''The sequence file'''  ====&lt;br /&gt;
&lt;br /&gt;
The example sequence file, shown below in abbreviated form, now includes the doubled sequence separated by a 48-element (LL2) linker: &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;MET      1&lt;br /&gt;
THR      2&lt;br /&gt;
SER      3&lt;br /&gt;
THR      4&lt;br /&gt;
PHE      5&lt;br /&gt;
ASP      6&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
HIS    100&lt;br /&gt;
HIS    101&lt;br /&gt;
&lt;br /&gt;
PL     102&lt;br /&gt;
LL2    103&lt;br /&gt;
LL2    104&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
LL2    148&lt;br /&gt;
LL2    149&lt;br /&gt;
LP     150&lt;br /&gt;
&lt;br /&gt;
MET    201&lt;br /&gt;
THR    202&lt;br /&gt;
SER    203&lt;br /&gt;
THR    204&lt;br /&gt;
PHE    205&lt;br /&gt;
ASP    206&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
HIS    300&lt;br /&gt;
HIS    301&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
==== The CALC.cya file  ====&lt;br /&gt;
&lt;br /&gt;
The working directory that contains all the files necessary to start the calcualtion is ready and the CALC.cya modified for the presence of RDC constraints is used:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;peaks      &amp;amp;nbsp;:= ali5.peaks,aro5.peaks,n3.peaks,xfilt.peaks  # names of NOESY peak lists&lt;br /&gt;
prot       &amp;amp;nbsp;:= RpR324d.prot               # names of chemical shift lists&lt;br /&gt;
restraints &amp;amp;nbsp;:= ssa.cya,hbonds.upl,hbonds.lol,manual.upl,dihed.aco  # additional (non-NOE) constraints&lt;br /&gt;
tolerance  &amp;amp;nbsp;:= 0.04,0.025,0.3            # chemical shift tolerances: HX2-HX1-X1&lt;br /&gt;
calibration&amp;amp;nbsp;:=                           # NOE calibration parameters&lt;br /&gt;
structures &amp;amp;nbsp;:= 100,20                    # number of initial, final structures&lt;br /&gt;
steps      &amp;amp;nbsp;:= 10000                     # number of torsion angle dynamics steps&lt;br /&gt;
rmsdrange  &amp;amp;nbsp;:= 10..80                    # residue range for RMSD calculation&lt;br /&gt;
randomseed &amp;amp;nbsp;:= 56231       # random number generator seed&lt;br /&gt;
&lt;br /&gt;
ssa&lt;br /&gt;
noeassign peaks=$peaks prot=$prot autoaco&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
==== Defining inter-chain only peaks  ====&lt;br /&gt;
&lt;br /&gt;
Notice the peak contain a list of intermolecular NOEs called xfilt.peaks.&amp;amp;nbsp; It is possible to instruct the program to make only interchain NOE&amp;amp;nbsp;assignments for the peaklist by using the 9 U&amp;amp;nbsp;xeasy color-code as shown below, the remaining peaklists can be treated as usual as a mixture of inter and intra chain NOEs.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Number of dimensions 3&lt;br /&gt;
#FORMAT xeasy3D&lt;br /&gt;
#INAME 1 h&lt;br /&gt;
#INAME 2 C&lt;br /&gt;
#INAME 3 H&lt;br /&gt;
#CYANAFORMAT hCH&lt;br /&gt;
      1   8.072  35.125   4.110 9 U   1.000E+06  0.000E+00 e 0     0     0     0&lt;br /&gt;
      2   2.584  33.247   4.446 9 U   3.610E+05  0.000E+00 e 0     0     0     0&lt;br /&gt;
      3   6.801  42.287   3.199 9 U   4.280E+05  0.000E+00 e 0     0     0     0&lt;br /&gt;
      4   6.799  42.276   2.940 9 U   3.440E+05  0.000E+00 e 0     0     0     0 &lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
==== The Init.cya file &amp;lt;br&amp;gt;  ====&lt;br /&gt;
&lt;br /&gt;
The new intstructions for symmetric dimer treatment are included in the init.cya file, in the example below molecule indentity and molecule symmetry are parametrized and adjustable (probably the parameters have been optimized so results tweaking the weight_ide and weight_sym should be carefully). &lt;br /&gt;
&amp;lt;pre&amp;gt;name:=RpR324&lt;br /&gt;
rmsdrange:=10-80&lt;br /&gt;
cyanalib&lt;br /&gt;
nproc:=8&lt;br /&gt;
read seq $name.seq&lt;br /&gt;
molecules define 1..101 201..301&lt;br /&gt;
molecule identity&lt;br /&gt;
weight_ide=0.03&lt;br /&gt;
molecule symdist &amp;quot;CA 1..101&amp;quot; &amp;quot;CA 201..301&amp;quot;&lt;br /&gt;
weight_sym=0.0025&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The weight of the symmetry and indentity constraints does not appear to be parametrized in the target function as a penalty.&amp;amp;nbsp; Further explanation will hopefully become available with the official release. &lt;br /&gt;
&lt;br /&gt;
The use of MPI&amp;amp;nbsp;routine is highly recommended due to the length of the calculation. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Output analysis &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The output analysis is carried out in the usual manner as for CYANA -2.1. &amp;lt;br&amp;gt; &amp;lt;br&amp;gt; &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 14 Dec 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_Calculation_With_RDC%27s_Using_CYANA&amp;diff=3299</id>
		<title>Structure Calculation With RDC's Using CYANA</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_Calculation_With_RDC%27s_Using_CYANA&amp;diff=3299"/>
		<updated>2009-12-15T21:21:16Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
'''IMPORTANT DISCLAIMER:'''&amp;amp;nbsp;A number of NESG&amp;amp;nbsp;NMR groups are currently beta-testing sites for CYANA-3.0 and the information in this page is intended for use by the licensed members of the NESG consortium, other beta testers, and is to be used in accordance to the program licensing agreement. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The following page describes the setup of and analysis of an automated structure determination starting from NOEs peaklists and residual dipolar coupling (RDC) constraints in the framework of CYANA 3.0.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
CYANA version 3.0 incorporates many new features including:&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
a) inclusion of residual dipolar coupling in structure calculation (RDC) &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
b) inclusion of pseudocontact shifts from paramagnetic centers in structure calculation (PCS)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
c) improved function for symmetric dimers and annotation of intermolecular NOE&amp;amp;nbsp;contacts in the peaklist using the xeasy color code notation. &amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Good agreement between global orientational constraints from RDC&amp;amp;nbsp;and distance information from NOEs is very important to achieve better structures by NMR.&amp;amp;nbsp; Results should always be accompanied by energy refinement in CNS or NIH-XPLOR.&amp;amp;nbsp; Further information about the program and publication references can be found in the [http://www.cyana.org/wiki/index.php/Main_Page CYANA WIKI]&amp;amp;nbsp;page.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Automated NOE and RDC and Structure Calculation Setup &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The structure calculation with automated noesy assignments and RDC&amp;amp;nbsp;restraints follows the canonical CYANA&amp;amp;nbsp;recipe.&amp;amp;nbsp; Simple annealing runs starting from a set of constraints that include RDC are easily derived by simplifying the scripts below and following the demo scripts. The program requires a sequence file (name.seq), a proton assignment list (name.prot), a noesy peaklist set (name.peaks), an RDC&amp;amp;nbsp;list (name.rdc), a CALC.cya script and an init.cya script.&amp;amp;nbsp;&amp;amp;nbsp; &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
==== Sequence file&amp;lt;br&amp;gt;  ====&lt;br /&gt;
&lt;br /&gt;
The sequence file now includes the RDC&amp;amp;nbsp;tensor origin separated by dummy linker residues (LL5): &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;MET      1&lt;br /&gt;
THR      2&lt;br /&gt;
SER      3&lt;br /&gt;
THR      4&lt;br /&gt;
PHE      5&lt;br /&gt;
ASP      6&lt;br /&gt;
ARG      7&lt;br /&gt;
VAL      8&lt;br /&gt;
ALA      9&lt;br /&gt;
THR     10&lt;br /&gt;
&lt;br /&gt;
PL     350&lt;br /&gt;
LL5    351&lt;br /&gt;
LL5    352&lt;br /&gt;
LL5    353&lt;br /&gt;
LL5    354&lt;br /&gt;
LL5    355&lt;br /&gt;
ORI    360&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
==== RDC&amp;amp;nbsp;constraint file&amp;lt;br&amp;gt;  ====&lt;br /&gt;
&lt;br /&gt;
The RDC&amp;amp;nbsp;list supports multiple interatomic vectors in multiple media. RDC&amp;amp;nbsp;with distinct scaling factors and distinct ORI&amp;amp;nbsp;residue numbers are listed in a single file. The program supports the Da (magnitude) and R (Rhombicity) notation typical of programs such as PALES, REDCAT etc. Below is a sample RDC file that includes N-H, N-CA (intra), and N-C' (sequential) vectors in one medium with adequate error (here the following errors were used:&amp;amp;nbsp; ~10&amp;amp;nbsp;% the RDC spread for N-H vectors, the error determined by analysis of ''J''-modulated experiments for N-CA and N-C' RDC measurement) and &amp;lt;span style=&amp;quot;text-decoration: underline;&amp;quot;&amp;gt;[http://www.ncbi.nlm.nih.gov/pubmed/18388951 weight factors]:&amp;lt;/span&amp;gt;&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Orientation  Magnitude  Rhombicity  ORI residue number&lt;br /&gt;
       1     5.39535        0.63125       360&lt;br /&gt;
#  First atom      Second atom                    RDC      Error  Weight  Orientation &lt;br /&gt;
     7    ARG      H       7    ARG     N        5.936     2.000   1.000  1&lt;br /&gt;
     8    VAL      H       8    VAL     N        3.827     2.000   1.000  1&lt;br /&gt;
     9    ALA      H       9    ALA     N       -2.822     2.000   1.000  1&lt;br /&gt;
    10    THR      H      10    THR     N       -0.674     2.000   1.000  1&lt;br /&gt;
    11    ILE      H      11    ILE     N        4.945     2.000   1.000  1&lt;br /&gt;
    12    ILE      H      12    ILE     N        1.709     2.000   1.000  1&lt;br /&gt;
    13    ALA      H      13    ALA     N       -1.336     2.000   1.000  1&lt;br /&gt;
#&lt;br /&gt;
    4     THR      N       3    SER     C        1.267     0.095   8.330  1&lt;br /&gt;
    5     PHE      N       4    THR     C       -0.246     0.207   8.330  1   &lt;br /&gt;
    7     ARG      N       6    ASP     C        0.161     0.052   8.330  1   &lt;br /&gt;
    8     VAL      N       7    ARG     C        0.439     0.034   8.330  1   &lt;br /&gt;
    9     ALA      N       8    VAL     C       -0.076     0.040   8.330  1   &lt;br /&gt;
   10     THR      N       9    ALA     C       -0.957     0.048   8.330  1   &lt;br /&gt;
   11     ILE      N      10    THR     C        1.123     0.022   8.330  1   &lt;br /&gt;
   12     ILE      N      11    ILE     C       -0.440     0.037   8.330  1   &lt;br /&gt;
   13     ALA      N      12    ILE     C        0.065     0.026   8.330  1   &lt;br /&gt;
#&lt;br /&gt;
    3     SER      N      3     SER    CA        0.251     0.199   8.330  1&lt;br /&gt;
    4     THR      N      4     THR    CA       -0.265     0.258   8.330  1&lt;br /&gt;
    5     PHE      N      5     PHE    CA       -0.499     0.281   8.330  1&lt;br /&gt;
    7     ARG      N      7     ARG    CA       -0.457     0.200   8.330  1&lt;br /&gt;
    8     VAL      N      8     VAL    CA       -0.481     0.154   8.330  1&lt;br /&gt;
    9     ALA      N      9     ALA    CA        0.349     0.083   8.330  1&lt;br /&gt;
   10     THR      N     10     THR    CA        0.548     0.121   8.330  1&lt;br /&gt;
   11     ILE      N     11     ILE    CA       -0.091     0.111   8.330  1&lt;br /&gt;
   12     ILE      N     12     ILE    CA       -0.678     0.078   8.330  1&lt;br /&gt;
   13     ALA      N     13     ALA    CA        1.014     0.108   8.330  1&amp;lt;/pre&amp;gt; &lt;br /&gt;
Multiple media (e.g. orientations) should be listed as follows: &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Orientation  Magnitude  Rhombicity  ORI residue number&lt;br /&gt;
       1     5.39535        0.63125       360&lt;br /&gt;
       2     7.55656        0.58200       370&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
and the sequence should be modified to include further links and ORI:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;ALA      9&lt;br /&gt;
THR     10&lt;br /&gt;
&lt;br /&gt;
PL     350&lt;br /&gt;
LL5    351&lt;br /&gt;
LL5    352&lt;br /&gt;
LL5    353&lt;br /&gt;
LL5    354&lt;br /&gt;
LL5    355&lt;br /&gt;
ORI    360&lt;br /&gt;
LL5    361&lt;br /&gt;
LL5    362&lt;br /&gt;
LL5    363&lt;br /&gt;
LL5    364&lt;br /&gt;
LL5    365&lt;br /&gt;
ORI    370&amp;lt;/pre&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==== Initial model-free determination of Da and R from assigned RDCs  ====&lt;br /&gt;
&lt;br /&gt;
If the values of Da and R are not known they can be determined using any desired software OR&amp;amp;nbsp;using the FindTensor.cya script below. The program yields results that are equivalent to PALES assiuming the same fitting method is employed.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;## 8DEMOS: FindTensor - Determine alignment tensor&lt;br /&gt;
##&lt;br /&gt;
## Determine magnitude and rhombicity of the alignment tensor&lt;br /&gt;
## from input RDCs&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
# determine tensor from histogram, no structure needed&lt;br /&gt;
&lt;br /&gt;
read rdc phage_all_mono.rdc&lt;br /&gt;
print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Input alignment tensor:&amp;quot;&lt;br /&gt;
do i 1 orientations&lt;br /&gt;
&amp;amp;nbsp; print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Orientation $i: magnitude = $magnitude(i) Hz, rhombicity = $rhombicity(i).&amp;quot;&lt;br /&gt;
end do&lt;br /&gt;
&lt;br /&gt;
rdc fittensor method=simplex&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; # (can take several minutes)&lt;br /&gt;
#rdc fittensor method=gridsearch&amp;amp;nbsp;&amp;amp;nbsp; # systematic search (very slow)&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
# alternatively, determine tensor from given structure by SVD&lt;br /&gt;
&lt;br /&gt;
read rdc phage_all_mono.rdc&lt;br /&gt;
read pdb final.pdb&lt;br /&gt;
overview&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The dummy values in the rdc list are read initially and they can be updated after running the FindTensor.cya routine. If no models are present (e.g. final.pdb) the program will terminate with a warning. &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==== The CALC.cya file ====&lt;br /&gt;
&lt;br /&gt;
The working directory that contains all the files necessary to start the calcualtion is ready and the CALC.cya modified for the presence of RDC constraints is used:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;peaks      &amp;amp;nbsp;:= ali5.peaks,aro5.peaks,n3.peaks  # names of NOESY peak lists&lt;br /&gt;
prot       &amp;amp;nbsp;:= RpR324.prot               # names of chemical shift lists&lt;br /&gt;
restraints &amp;amp;nbsp;:= ssa.cya,phage_all_mono.rdc # additional (non-NOE) constraints&lt;br /&gt;
tolerance  &amp;amp;nbsp;:= 0.04,0.025,0.3            # chemical shift tolerances: HX2-HX1-X1&lt;br /&gt;
calibration&amp;amp;nbsp;:=                           # NOE calibration parameters&lt;br /&gt;
structures &amp;amp;nbsp;:= 100,20                    # number of initial, final structures&lt;br /&gt;
steps      &amp;amp;nbsp;:= 10000                     # number of torsion angle dynamics steps&lt;br /&gt;
rmsdrange  &amp;amp;nbsp;:= 10..80                    # residue range for RMSD calculation&lt;br /&gt;
randomseed &amp;amp;nbsp;:= 56231       # random number generator seed&lt;br /&gt;
&lt;br /&gt;
weight_rdc   = 0.02               # weight for RDC restraints&lt;br /&gt;
cut_rdc      = 0.2                # cutoff for RDC violation output&lt;br /&gt;
&lt;br /&gt;
ssa&lt;br /&gt;
noeassign peaks=$peaks prot=$prot autoaco&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
Notice that the 'restraints' row contain the forced stereospecifically assigned methyls and sidechain NH's and the .rdc file.&amp;amp;nbsp; Also, the NOE vs. RDC&amp;amp;nbsp;weight is set by the weight_rdc and cut_rdc functions.&amp;amp;nbsp; The remaining instructions are identical to the CYANA-2.1 file.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==== The init.cya file ====&lt;br /&gt;
&lt;br /&gt;
Further parameters are specified in the init.cya file below:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;name:=RpR324&lt;br /&gt;
rmsdrange:=10-80&lt;br /&gt;
cyanalib&lt;br /&gt;
nproc:=8&lt;br /&gt;
read seq $name.seq&lt;br /&gt;
rdcdistances&amp;lt;/pre&amp;gt; &lt;br /&gt;
The above script is intended to run off a single dual-quad core machine (nproc=8).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
===== rdcdistances.cya file =====&lt;br /&gt;
&lt;br /&gt;
Please note the rdcdistance.cya macro is being called by the init.cya setup file.&amp;amp;nbsp; This file, located in the cyana-3.0/macro directory contains the supported RDC&amp;amp;nbsp;vectors, more vectors could potentially be added such as Trp N&amp;lt;sup&amp;gt;ε1&amp;lt;/sup&amp;gt;-H&amp;lt;sup&amp;gt;ε1&amp;lt;/sup&amp;gt; that maybe useful in deuterated sample to direct the large hydrophobic sidechain.&amp;amp;nbsp; &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Copyright (c) 2002-08 Peter Guntert. All rights reserved.&lt;br /&gt;
## 7MACROS: rdcdistances - CYANA macro&lt;br /&gt;
##&lt;br /&gt;
## Parameters: (none)&lt;br /&gt;
##&lt;br /&gt;
# dipole definition format: atom1_name atom2_name atom1_index atom2_index&lt;br /&gt;
# if indexes are missing, zeros are assumed&lt;br /&gt;
&lt;br /&gt;
var info echo&lt;br /&gt;
&lt;br /&gt;
syntax&lt;br /&gt;
&lt;br /&gt;
info:=none; echo:=off&lt;br /&gt;
rdc distance &amp;quot;N&amp;amp;nbsp; H&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.041&lt;br /&gt;
rdc distance &amp;quot;CA HA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.117&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; CA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.525&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; N&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.461&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; N -1&amp;quot; distance=1.329&lt;br /&gt;
rdc distance &amp;quot;CA N&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.458&lt;br /&gt;
rdc distance &amp;quot;CA N -1&amp;quot; distance=2.425&lt;br /&gt;
rdc distance &amp;quot;CA H&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.117&lt;br /&gt;
rdc distance &amp;quot;CA H -1&amp;quot; distance=2.533&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; H -1&amp;quot; distance=2.000&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; HA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.144&lt;br /&gt;
rdc distance &amp;quot;CB HB&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.080&lt;br /&gt;
rdc distance &amp;quot;CA CB&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.532&lt;br /&gt;
unset info&lt;br /&gt;
print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Standard RDC distances defined.&amp;quot;&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==== Notes on run execution ====&lt;br /&gt;
&lt;br /&gt;
The command line execution form single machine or cluster using MPI implememntation (highly recommended) is carried on as usual:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/cyana-3.0/cyana CALC &amp;amp;gt; &amp;amp;amp; log &amp;amp;amp;&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
the MPI&amp;amp;nbsp;is launched using the script called, for example, submit_cyana:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;#!/bin/bash&lt;br /&gt;
#PBS -S /bin/bash&lt;br /&gt;
#PBS -N cyana&lt;br /&gt;
#PBS -lnodes=6:ppn=8&lt;br /&gt;
lamboot ~/bhost.def&lt;br /&gt;
cd /farm/users/prossi/RpR324_structure/cyana_new_mono2&lt;br /&gt;
/opt/openmpi/tcp-gnu/bin/mpirun /farm/software/cyana-3.0-mpi/cyana CALC.cya&lt;br /&gt;
lamhalt&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt;with the command:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;qsub -q @master3 submit_cyana&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The starting scripts are highly system specific they are almost guaranteed NOT&amp;amp;nbsp;to work on your sytem and are given here for general information only. &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Output analysis &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The output analysis is carried out in the usual manner, it should be noted that, during the calculation the specified values Da and R are kept fixed.&amp;amp;nbsp; Following the final cycle a new model-based estimate of Da and R&amp;amp;nbsp;is calculated and used to compute the RDC violations and their contribution to the target function and the quality factor (Q). The resulting target function will be increased by the number and extent of RDC&amp;amp;nbsp;violations in addition to other violations from dihedral, vdw, and NOEs restraints. &lt;br /&gt;
&lt;br /&gt;
A partial output file is given below (final.ovw):&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt; &lt;br /&gt;
    Structural statistics:&lt;br /&gt;
 &lt;br /&gt;
    str   target     upper limits    van der Waals             RDCs&lt;br /&gt;
        function   #    rms   max   #    sum   max   #    rms   max&lt;br /&gt;
      1     8.98   5 0.0089  0.40  12   18.5  0.37  13 0.2508  2.27&lt;br /&gt;
      2     8.96   7 0.0083  0.31  15   17.4  0.38  19 0.2656  2.27&lt;br /&gt;
      3     9.69  11 0.0122  0.54  15   18.6  0.38  18 0.2595  2.28&lt;br /&gt;
      4     9.63   6 0.0068  0.20  16   18.9  0.38  18 0.2604  2.27&lt;br /&gt;
      5     9.41  14 0.0089  0.22  17   20.4  0.37  14 0.2521  2.26&lt;br /&gt;
      6     9.80  10 0.0085  0.24  17   19.7  0.38  15 0.2563  2.27&lt;br /&gt;
      7    10.52  12 0.0158  0.78  15   19.1  0.38  13 0.2554  2.29&lt;br /&gt;
      8    10.05  10 0.0084  0.18  18   20.3  0.42  18 0.2587  2.28&lt;br /&gt;
      9    10.57   7 0.0079  0.29  19   18.3  0.53  16 0.3169  2.43&lt;br /&gt;
     10    10.38  13 0.0088  0.21  22   20.5  0.37  21 0.2636  2.28&lt;br /&gt;
     11    10.33   7 0.0067  0.16  17   19.6  0.64  15 0.2663  2.28&lt;br /&gt;
     12     9.93   9 0.0090  0.29  19   20.6  0.38  20 0.2541  2.27&lt;br /&gt;
     13    10.12  12 0.0098  0.23  21   19.9  0.47  13 0.2681  2.30&lt;br /&gt;
     14    10.53   7 0.0077  0.19  23   19.3  0.38  11 0.3145  2.40&lt;br /&gt;
     15    10.96   8 0.0089  0.31  21   22.6  0.38  12 0.2639  2.28&lt;br /&gt;
     16    10.50  12 0.0100  0.29  23   20.1  0.37  15 0.2696  2.27&lt;br /&gt;
     17    10.56  14 0.0119  0.30  23   21.1  0.37  16 0.2736  2.33&lt;br /&gt;
     18    10.75  17 0.0146  0.60  21   20.0  0.37  12 0.2547  2.27&lt;br /&gt;
     19    10.88  18 0.0125  0.38  19   23.3  0.38  10 0.2506  2.30&lt;br /&gt;
     20    10.88   8 0.0083  0.26  23   21.4  0.42  15 0.2644  2.28&lt;br /&gt;
 &lt;br /&gt;
    Ave    10.17  10 0.0097  0.32  19   20.0  0.41  15 0.2660  2.29&lt;br /&gt;
    +/-     0.59   4 0.0024  0.15   3    1.4  0.07   3 0.0177  0.04&lt;br /&gt;
    Min     8.96   5 0.0067  0.16  12   17.4  0.37  10 0.2506  2.26&lt;br /&gt;
    Max    10.96  18 0.0158  0.78  23   23.3  0.64  21 0.3169  2.43&lt;br /&gt;
    Cut                      0.10             0.20             0.20&lt;br /&gt;
 &lt;br /&gt;
    Constraints violated in 6 or more structures:&lt;br /&gt;
                                                   #   mean   max.  1   5   10   15   20&lt;br /&gt;
    Upper HA    PRO   19 - HB3   ARG   20   5.50  15   0.11   0.21  +++++++  ++++   ++*+  peak 970&lt;br /&gt;
    Upper HA    ILE   23 - QB    SER   27   5.34   6   0.09   0.16         + ++   +  +*   peak 276&lt;br /&gt;
    Upper HA    ILE   30 - HB2   LEU   33   4.95  10   0.10   0.15      ++++  ++  ++ +*   peak 313&lt;br /&gt;
    VdW   CB    ALA   69 - H     THR   70   2.55  18   0.24   0.28  ++++++++ ++++ *+++++&lt;br /&gt;
    VdW   O     THR   71 - N     PHE   75   2.75  12   0.20   0.32   ++* +++  +   ++ +++&lt;br /&gt;
    VdW   O     PHE   75 - C     VAL   76   2.80  13   0.21   0.31      ++++ +  *+++++++&lt;br /&gt;
    VdW   CG1   VAL   76 - HG2   LYS   78   2.60   9   0.17   0.25   ++*   +++++   +&lt;br /&gt;
    VdW   HG3   LYS   78 - C     LYS   78   2.50  14   0.22   0.36  +++*++ +++++ + +  +&lt;br /&gt;
    Ori 1 N     ALA   69 - CA    ALA   69  -2.84  20   1.95   2.04  +++++++++++++*++++++&lt;br /&gt;
    Ori 1 H     ALA   69 - N     ALA   69  -3.32  20   2.01   2.33  ++++++++++++++++*+++&lt;br /&gt;
    Ori 1 N     THR   70 - C     ALA   69   0.25  16   0.31   1.06  ++++++++*+++ + +  ++&lt;br /&gt;
    Ori 1 H     ASN   79 - N     ASN   79  -4.71  10   0.17   0.32  + *+ +  ++++   +  +&lt;br /&gt;
    Ori 1 H     GLY   92 - N     GLY   92  -5.54   8   0.15   0.51     ++++*       +  ++&lt;br /&gt;
    Ori 1 H     LEU   94 - N     LEU   94   0.42   6   0.14   0.54   +*+     +++&lt;br /&gt;
    3 violated distance restraints.&lt;br /&gt;
    5 violated van der Waals restraints.&lt;br /&gt;
    6 violated residual dipolar coupling restraints.&lt;br /&gt;
 &lt;br /&gt;
 &lt;br /&gt;
    RDC statistics:&lt;br /&gt;
    Correlation coefficient     &amp;amp;nbsp;:    0.906 +/-  0.003    (0.899..0.909, best in conformer 4)&lt;br /&gt;
    Q = rms(Dcalc-Dobs)/rms(Dobs):   42.709 +/-  0.583&amp;amp;nbsp;%  (42.073..44.194)&lt;br /&gt;
    Q normalized by tensor      &amp;amp;nbsp;:   32.943 +/-  0.638&amp;amp;nbsp;%  (32.231..34.776)&lt;br /&gt;
    Alignment tensor magnitude  &amp;amp;nbsp;:    5.881 +/-  0.045 Hz (5.760..5.950, best 5.898; input 5.898)&lt;br /&gt;
    Alignment tensor rhombicity &amp;amp;nbsp;:    0.537 +/-  0.007    (0.524..0.556, best 0.539; input 0.539)&lt;br /&gt;
 &lt;br /&gt;
 &lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 14 Dec 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Homodimer_Structure_Calculation_with_Symmetry_Constraints&amp;diff=3295</id>
		<title>Homodimer Structure Calculation with Symmetry Constraints</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Homodimer_Structure_Calculation_with_Symmetry_Constraints&amp;diff=3295"/>
		<updated>2009-12-15T21:06:07Z</updated>

		<summary type="html">&lt;p&gt;Prossi: Created page with '== '''Introduction'''  ==  '''IMPORTANT DISCLAIMER:'''&amp;amp;nbsp;A number of NESG&amp;amp;nbsp;NMR groups are currently beta-testing sites for CYANA-3.0 and the information in this page is in…'&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
'''IMPORTANT DISCLAIMER:'''&amp;amp;nbsp;A number of NESG&amp;amp;nbsp;NMR groups are currently beta-testing sites for CYANA-3.0 and the information in this page is intended for use by the licensed members of the NESG consortium, other beta testers, and is to be used in accordance to the program licensing agreement. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The following page describes the setup and analysis of an automated structure determination run for symmertic homodimers starting from NOE peaklists in the framework of CYANA-3.0.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;Results from CYANA&amp;amp;nbsp;should always be accompanied by energy refinement in CNS or NIH-XPLOR.&amp;amp;nbsp; Further information about the program and publication references can be found in the [http://www.cyana.org/wiki/index.php/Main_Page CYANA WIKI]&amp;amp;nbsp;page. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Automated Homodimer Structure Calculation Setup &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The structure calculation with automated noesy assignments and intermolecular restraints follows the canonical CYANA&amp;amp;nbsp;recipe.&amp;amp;nbsp; Simple annealing calculations starting from a set of constraints that include RDC are easily derived by simplifying the scripts below and following the demo scripts. The program requires a sequence file (name.seq), a proton assignment list (name.prot), a noesy peaklist set (name.peaks), a CALC.cya script and an init.cya script.&amp;amp;nbsp;&amp;amp;nbsp; &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
An helpful script called '''DIMERIZE''', to be run from within CYANA, can be used to symmetrize various files such as the proton (.prot), angle and NOE constraint files:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;!/bin/sh&lt;br /&gt;
&lt;br /&gt;
# Chemical shift list&lt;br /&gt;
cp RpR324.prot RpR324d.prot&lt;br /&gt;
awk 'NF&amp;amp;gt;=5 { printf(&amp;quot;%6d%8.3f%8.3f&amp;amp;nbsp;%-5s%4d\n&amp;quot;,$1+1000,$2,$3,$4,$5+200) }' $* RpR324.prot &amp;amp;gt;&amp;amp;gt; RpR324d.prot&lt;br /&gt;
&lt;br /&gt;
# Additional distance constraints&lt;br /&gt;
echo &amp;quot;&lt;br /&gt;
read upl D5.upl&lt;br /&gt;
read lol D5.lol&lt;br /&gt;
molecules symmetrize&lt;br /&gt;
write upl D5dimer.upl&lt;br /&gt;
write lol D5dimer.lol&lt;br /&gt;
quit&amp;quot; | cyana32&lt;br /&gt;
&lt;br /&gt;
# angle constraints&lt;br /&gt;
echo &amp;quot;&lt;br /&gt;
read dihe.aco&lt;br /&gt;
shift +200&lt;br /&gt;
writeaco t.aco&lt;br /&gt;
quit&amp;quot; | ancoma&lt;br /&gt;
cat dihe.aco t.aco &amp;amp;gt; dihed.aco&lt;br /&gt;
rm -f t.aco&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
==== '''Sequence file'''  ====&lt;br /&gt;
&lt;br /&gt;
The example sequence file, shown below in abbreviated form, now includes the doubled sequence separated by a 48-element (LL2) linker: &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;MET      1&lt;br /&gt;
THR      2&lt;br /&gt;
SER      3&lt;br /&gt;
THR      4&lt;br /&gt;
PHE      5&lt;br /&gt;
ASP      6&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
HIS    100&lt;br /&gt;
HIS    101&lt;br /&gt;
&lt;br /&gt;
PL     102&lt;br /&gt;
LL2    103&lt;br /&gt;
LL2    104&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
LL2    148&lt;br /&gt;
LL2    149&lt;br /&gt;
LP     150&lt;br /&gt;
&lt;br /&gt;
MET    201&lt;br /&gt;
THR    202&lt;br /&gt;
SER    203&lt;br /&gt;
THR    204&lt;br /&gt;
PHE    205&lt;br /&gt;
ASP    206&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
.&lt;br /&gt;
HIS    300&lt;br /&gt;
HIS    301&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
==== CALC.cya file  ====&lt;br /&gt;
&lt;br /&gt;
The working directory that contains all the files necessary to start the calcualtion is ready and the CALC.cya modified for the presence of RDC constraints is used:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;peaks      &amp;amp;nbsp;:= ali5.peaks,aro5.peaks,n3.peaks,xfilt.peaks  # names of NOESY peak lists&lt;br /&gt;
prot       &amp;amp;nbsp;:= RpR324d.prot               # names of chemical shift lists&lt;br /&gt;
restraints &amp;amp;nbsp;:= ssa.cya,hbonds.upl,hbonds.lol,manual.upl,dihed.aco  # additional (non-NOE) constraints&lt;br /&gt;
tolerance  &amp;amp;nbsp;:= 0.04,0.025,0.3            # chemical shift tolerances: HX2-HX1-X1&lt;br /&gt;
calibration&amp;amp;nbsp;:=                           # NOE calibration parameters&lt;br /&gt;
structures &amp;amp;nbsp;:= 100,20                    # number of initial, final structures&lt;br /&gt;
steps      &amp;amp;nbsp;:= 10000                     # number of torsion angle dynamics steps&lt;br /&gt;
rmsdrange  &amp;amp;nbsp;:= 10..80                    # residue range for RMSD calculation&lt;br /&gt;
randomseed &amp;amp;nbsp;:= 56231       # random number generator seed&lt;br /&gt;
&lt;br /&gt;
ssa&lt;br /&gt;
noeassign peaks=$peaks prot=$prot autoaco&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
==== Defining inter-chain only peaks  ====&lt;br /&gt;
&lt;br /&gt;
Notice the peak contain a list of intermolecular NOEs called xfilt.peaks.&amp;amp;nbsp; It is possible to instruct the program to make only interchain NOE&amp;amp;nbsp;assignments for the peaklist by using the 9 U&amp;amp;nbsp;xeasy color-code as shown below, the remaining peaklists can be treated as usual as a mixture of inter and intra chain NOEs.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Number of dimensions 3&lt;br /&gt;
#FORMAT xeasy3D&lt;br /&gt;
#INAME 1 h&lt;br /&gt;
#INAME 2 C&lt;br /&gt;
#INAME 3 H&lt;br /&gt;
#CYANAFORMAT hCH&lt;br /&gt;
      1   8.072  35.125   4.110 9 U   1.000E+06  0.000E+00 e 0     0     0     0&lt;br /&gt;
      2   2.584  33.247   4.446 9 U   3.610E+05  0.000E+00 e 0     0     0     0&lt;br /&gt;
      3   6.801  42.287   3.199 9 U   4.280E+05  0.000E+00 e 0     0     0     0&lt;br /&gt;
      4   6.799  42.276   2.940 9 U   3.440E+05  0.000E+00 e 0     0     0     0 &lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
==== Init.cya file &amp;lt;br&amp;gt;  ====&lt;br /&gt;
&lt;br /&gt;
The new intstructions for symmetric dimer treatment are included in the init.cya file, in the example below molecule indentity and molecule symmetry are parametrized and adjustable (probably the parameters have been optimized so results tweaking the weight_ide and weight_sym should be carefully). &lt;br /&gt;
&amp;lt;pre&amp;gt;name:=RpR324&lt;br /&gt;
rmsdrange:=10-80&lt;br /&gt;
cyanalib&lt;br /&gt;
nproc:=8&lt;br /&gt;
read seq $name.seq&lt;br /&gt;
molecules define 1..101 201..301&lt;br /&gt;
molecule identity&lt;br /&gt;
weight_ide=0.03&lt;br /&gt;
molecule symdist &amp;quot;CA 1..101&amp;quot; &amp;quot;CA 201..301&amp;quot;&lt;br /&gt;
weight_sym=0.0025&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The weight of the symmetry and indentity constraints does not appear to be parametrized in the target function as a penalty.&amp;amp;nbsp; Further explanation will hopefully become available with the official release. &lt;br /&gt;
&lt;br /&gt;
The use of MPI&amp;amp;nbsp;routine is highly recommended due to the length of the calculation. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Output analysis &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The output analysis is carried out in the usual manner as for CYANA -2.1. &amp;lt;br&amp;gt; &amp;lt;br&amp;gt; &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 14 Dec 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_Calculation_With_RDC%27s_Using_CYANA&amp;diff=3293</id>
		<title>Structure Calculation With RDC's Using CYANA</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_Calculation_With_RDC%27s_Using_CYANA&amp;diff=3293"/>
		<updated>2009-12-15T20:26:08Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
'''IMPORTANT DISCLAIMER:'''&amp;amp;nbsp;A number of NESG&amp;amp;nbsp;NMR groups are currently beta-testing sites for CYANA-3.0 and the information in this page is intended for use by the licensed members of the NESG consortium, other beta testers, and is to be used in accordance to the program licensing agreement. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The following page describes the setup of and analysis of an automated structure determination starting from NOEs peaklists and residual dipolar coupling (RDC) constraints in the framework of CYANA 3.0.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
CYANA version 3.0 incorporates many new features including:&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
a) inclusion of residual dipolar coupling in structure calculation (RDC) &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
b) inclusion of pseudocontact shifts from paramagnetic centers in structure calculation (PCS)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
c) improved function for symmetric dimers and annotation of intermolecular NOE&amp;amp;nbsp;contacts in the peaklist using the xeasy color code notation. &amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Good agreement between global orientational constraints from RDC&amp;amp;nbsp;and distance information from NOEs is very important to achieve better structures by NMR. The program is an excellent step forward.&amp;amp;nbsp; Results should always be accompanied by energy refinement in CNS or NIH-XPLOR.&amp;amp;nbsp; Further information about the program and publication references can be found in the [http://www.cyana.org/wiki/index.php/Main_Page CYANA WIKI]&amp;amp;nbsp;page.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Automated NOE and RDC and Structure Calculation Setup &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The structure calculation with automated noesy assignments and RDC&amp;amp;nbsp;restraints follows the canonical CYANA&amp;amp;nbsp;recipe.&amp;amp;nbsp; Simple annealing calcualtions starting from a set of constraints that include RDC are easily derived by simplifying the scripts below and following the demo scripts. The program requires a sequence file (name.seq), a proton assignment list (name.prot), a noesy peaklist set (name.peaks), an RDC&amp;amp;nbsp;list (name.rdc), a CALC.cya script and an init.cya script.&amp;amp;nbsp;&amp;amp;nbsp; &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The sequence file now includes the RDC&amp;amp;nbsp;tensor origin separated by dummy linker residues: &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;MET      1&lt;br /&gt;
THR      2&lt;br /&gt;
SER      3&lt;br /&gt;
THR      4&lt;br /&gt;
PHE      5&lt;br /&gt;
ASP      6&lt;br /&gt;
ARG      7&lt;br /&gt;
VAL      8&lt;br /&gt;
ALA      9&lt;br /&gt;
THR     10&lt;br /&gt;
&lt;br /&gt;
PL     350&lt;br /&gt;
LL5    351&lt;br /&gt;
LL5    352&lt;br /&gt;
LL5    353&lt;br /&gt;
LL5    354&lt;br /&gt;
LL5    355&lt;br /&gt;
ORI    360&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The RDC&amp;amp;nbsp;list supports multiple interatomic vectors in multiple media. RDC&amp;amp;nbsp;with distinct scaling factors and distinct ORI&amp;amp;nbsp;residue numbers are listed in a single file. The program supports the Da (magnitude) and R (Rhombicity) notation typical of programs such as PALES, REDCAT etc. Below is a sample RDC file that includes N-H, N-CA (intra), and N-C' (sequential) vectors in one medium with appropriate errors and [http://www.ncbi.nlm.nih.gov/pubmed/18388951 scaling factors]:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Orientation  Magnitude  Rhombicity  ORI residue number&lt;br /&gt;
       1     5.39535        0.63125       360&lt;br /&gt;
#  First atom      Second atom                    RDC      Error  Weight  Orientation &lt;br /&gt;
     7    ARG      H       7    ARG     N        5.936     2.000   1.000  1&lt;br /&gt;
     8    VAL      H       8    VAL     N        3.827     2.000   1.000  1&lt;br /&gt;
     9    ALA      H       9    ALA     N       -2.822     2.000   1.000  1&lt;br /&gt;
    10    THR      H      10    THR     N       -0.674     2.000   1.000  1&lt;br /&gt;
    11    ILE      H      11    ILE     N        4.945     2.000   1.000  1&lt;br /&gt;
    12    ILE      H      12    ILE     N        1.709     2.000   1.000  1&lt;br /&gt;
    13    ALA      H      13    ALA     N       -1.336     2.000   1.000  1&lt;br /&gt;
#&lt;br /&gt;
    4     THR      N       3    SER     C        1.267     0.095   8.330  1&lt;br /&gt;
    5     PHE      N       4    THR     C       -0.246     0.207   8.330  1   &lt;br /&gt;
    7     ARG      N       6    ASP     C        0.161     0.052   8.330  1   &lt;br /&gt;
    8     VAL      N       7    ARG     C        0.439     0.034   8.330  1   &lt;br /&gt;
    9     ALA      N       8    VAL     C       -0.076     0.040   8.330  1   &lt;br /&gt;
   10     THR      N       9    ALA     C       -0.957     0.048   8.330  1   &lt;br /&gt;
   11     ILE      N      10    THR     C        1.123     0.022   8.330  1   &lt;br /&gt;
   12     ILE      N      11    ILE     C       -0.440     0.037   8.330  1   &lt;br /&gt;
   13     ALA      N      12    ILE     C        0.065     0.026   8.330  1   &lt;br /&gt;
#&lt;br /&gt;
    3     SER      N      3     SER    CA        0.251     0.199   8.330  1&lt;br /&gt;
    4     THR      N      4     THR    CA       -0.265     0.258   8.330  1&lt;br /&gt;
    5     PHE      N      5     PHE    CA       -0.499     0.281   8.330  1&lt;br /&gt;
    7     ARG      N      7     ARG    CA       -0.457     0.200   8.330  1&lt;br /&gt;
    8     VAL      N      8     VAL    CA       -0.481     0.154   8.330  1&lt;br /&gt;
    9     ALA      N      9     ALA    CA        0.349     0.083   8.330  1&lt;br /&gt;
   10     THR      N     10     THR    CA        0.548     0.121   8.330  1&lt;br /&gt;
   11     ILE      N     11     ILE    CA       -0.091     0.111   8.330  1&lt;br /&gt;
   12     ILE      N     12     ILE    CA       -0.678     0.078   8.330  1&lt;br /&gt;
   13     ALA      N     13     ALA    CA        1.014     0.108   8.330  1&amp;lt;/pre&amp;gt; &lt;br /&gt;
Multiple media (e.g. orientations) should be listed as follows: &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Orientation  Magnitude  Rhombicity  ORI residue number&lt;br /&gt;
       1     5.39535        0.63125       360&lt;br /&gt;
       2     7.55656        0.58200       370&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
and the sequence should be modified to include further links and ORI:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;ALA      9&lt;br /&gt;
THR     10&lt;br /&gt;
&lt;br /&gt;
PL     350&lt;br /&gt;
LL5    351&lt;br /&gt;
LL5    352&lt;br /&gt;
LL5    353&lt;br /&gt;
LL5    354&lt;br /&gt;
LL5    355&lt;br /&gt;
ORI    360&lt;br /&gt;
LL5    361&lt;br /&gt;
LL5    362&lt;br /&gt;
LL5    363&lt;br /&gt;
LL5    364&lt;br /&gt;
LL5    365&lt;br /&gt;
ORI    370&amp;lt;/pre&amp;gt; &lt;br /&gt;
If the values of Da and R are not known they can be determined using any desired software OR&amp;amp;nbsp;using the FindTensor.cya script below. The program yields results that are equivalent to PALES assiuming the same fitting method is employed.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;## 8DEMOS: FindTensor - Determine alignment tensor&lt;br /&gt;
##&lt;br /&gt;
## Determine magnitude and rhombicity of the alignment tensor&lt;br /&gt;
## from input RDCs&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
# determine tensor from histogram, no structure needed&lt;br /&gt;
&lt;br /&gt;
read rdc phage_all_mono.rdc&lt;br /&gt;
print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Input alignment tensor:&amp;quot;&lt;br /&gt;
do i 1 orientations&lt;br /&gt;
&amp;amp;nbsp; print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Orientation $i: magnitude = $magnitude(i) Hz, rhombicity = $rhombicity(i).&amp;quot;&lt;br /&gt;
end do&lt;br /&gt;
&lt;br /&gt;
rdc fittensor method=simplex&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; # (can take several minutes)&lt;br /&gt;
#rdc fittensor method=gridsearch&amp;amp;nbsp;&amp;amp;nbsp; # systematic search (very slow)&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
# alternatively, determine tensor from given structure by SVD&lt;br /&gt;
&lt;br /&gt;
read rdc phage_all_mono.rdc&lt;br /&gt;
read pdb final.pdb&lt;br /&gt;
overview&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The dummy values in the rdc list are read initially and they can be updated after running the FindTensor.cya routine. If no models are present (e.g. final.pdb) the program will terminate with a warning. &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The working directory that contains all the files necessary to start the calcualtion is ready and the CALC.cya modified for the presence of RDC constraints is used:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;peaks      &amp;amp;nbsp;:= ali5.peaks,aro5.peaks,n3.peaks  # names of NOESY peak lists&lt;br /&gt;
prot       &amp;amp;nbsp;:= RpR324.prot               # names of chemical shift lists&lt;br /&gt;
restraints &amp;amp;nbsp;:= ssa.cya,phage_all_mono.rdc # additional (non-NOE) constraints&lt;br /&gt;
tolerance  &amp;amp;nbsp;:= 0.04,0.025,0.3            # chemical shift tolerances: HX2-HX1-X1&lt;br /&gt;
calibration&amp;amp;nbsp;:=                           # NOE calibration parameters&lt;br /&gt;
structures &amp;amp;nbsp;:= 100,20                    # number of initial, final structures&lt;br /&gt;
steps      &amp;amp;nbsp;:= 10000                     # number of torsion angle dynamics steps&lt;br /&gt;
rmsdrange  &amp;amp;nbsp;:= 10..80                    # residue range for RMSD calculation&lt;br /&gt;
randomseed &amp;amp;nbsp;:= 56231       # random number generator seed&lt;br /&gt;
&lt;br /&gt;
weight_rdc   = 0.02               # weight for RDC restraints&lt;br /&gt;
cut_rdc      = 0.2                # cutoff for RDC violation output&lt;br /&gt;
&lt;br /&gt;
ssa&lt;br /&gt;
noeassign peaks=$peaks prot=$prot autoaco&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
Notice the restraint contain the forced stereospecifically assigned methyls and sidechain NH's and the RDC&amp;amp;nbsp;set.&amp;amp;nbsp; Also, the NOE vs. RDC&amp;amp;nbsp;weight is set by the weight_rdc and cut_rdc functions. The remaining instructions are identical to the CYANA-2.1 file.&amp;amp;nbsp; Further parameters are specified in the init.cya file below:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;name:=RpR324&lt;br /&gt;
rmsdrange:=10-80&lt;br /&gt;
cyanalib&lt;br /&gt;
nproc:=8&lt;br /&gt;
read seq $name.seq&lt;br /&gt;
rdcdistances&amp;lt;/pre&amp;gt; &lt;br /&gt;
The above script is intended to run off a single dual-quad core machine (nproc=8).&amp;amp;nbsp; Please note the rdcdistance.cya macro is being called by the init.cya setup file.&amp;amp;nbsp; This file, located in the cyana-3.0/macro directory contains the supported RDC&amp;amp;nbsp;vectors, more vectors could potentially be added such as Trp N&amp;lt;sup&amp;gt;ε1&amp;lt;/sup&amp;gt;-H&amp;lt;sup&amp;gt;ε1&amp;lt;/sup&amp;gt; that maybe useful in deuterated sample to direct the large hydrophobic sidechain.&amp;amp;nbsp; &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Copyright (c) 2002-08 Peter Guntert. All rights reserved.&lt;br /&gt;
## 7MACROS: rdcdistances - CYANA macro&lt;br /&gt;
##&lt;br /&gt;
## Parameters: (none)&lt;br /&gt;
##&lt;br /&gt;
# dipole definition format: atom1_name atom2_name atom1_index atom2_index&lt;br /&gt;
# if indexes are missing, zeros are assumed&lt;br /&gt;
&lt;br /&gt;
var info echo&lt;br /&gt;
&lt;br /&gt;
syntax&lt;br /&gt;
&lt;br /&gt;
info:=none; echo:=off&lt;br /&gt;
rdc distance &amp;quot;N&amp;amp;nbsp; H&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.041&lt;br /&gt;
rdc distance &amp;quot;CA HA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.117&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; CA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.525&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; N&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.461&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; N -1&amp;quot; distance=1.329&lt;br /&gt;
rdc distance &amp;quot;CA N&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.458&lt;br /&gt;
rdc distance &amp;quot;CA N -1&amp;quot; distance=2.425&lt;br /&gt;
rdc distance &amp;quot;CA H&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.117&lt;br /&gt;
rdc distance &amp;quot;CA H -1&amp;quot; distance=2.533&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; H -1&amp;quot; distance=2.000&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; HA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.144&lt;br /&gt;
rdc distance &amp;quot;CB HB&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.080&lt;br /&gt;
rdc distance &amp;quot;CA CB&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.532&lt;br /&gt;
unset info&lt;br /&gt;
print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Standard RDC distances defined.&amp;quot;&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The command line execution form single machine or cluster using MPI implememntation (highly recommended) is carried on as usual:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/cyana-3.0/cyana CALC &amp;amp;gt; &amp;amp;amp; log &amp;amp;amp;&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
the MPI&amp;amp;nbsp;is launched using the script called, for example, submit_cyana:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;#!/bin/bash&lt;br /&gt;
#PBS -S /bin/bash&lt;br /&gt;
#PBS -N cyana&lt;br /&gt;
#PBS -lnodes=6:ppn=8&lt;br /&gt;
lamboot ~/bhost.def&lt;br /&gt;
cd /farm/users/prossi/RpR324_structure/cyana_new_mono2&lt;br /&gt;
/opt/openmpi/tcp-gnu/bin/mpirun /farm/software/cyana-3.0-mpi/cyana CALC.cya&lt;br /&gt;
lamhalt&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt;with the command:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;qsub -q @master3 submit_cyana&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The starting scripts are highly system specific they are almost guaranteed NOT&amp;amp;nbsp;to work on your sytem and are given here for general information only. &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Output analysis &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The output analysis is carried out in the usual manner, it should be noted that, during the calculation the specified values Da and R are kept fixed.&amp;amp;nbsp; Following the final cycle a new model-based estimate of Da and R&amp;amp;nbsp;is calculated and used to compute the RDC violations and their contribution to the target function and the quality factor (Q). The resulting target function will be increased by the number and extent of RDC&amp;amp;nbsp;violations in addition to other violations from dihedral, vdw, and NOEs restraints. &lt;br /&gt;
&lt;br /&gt;
A partial output file is given below (final.ovw):&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt; &lt;br /&gt;
    Structural statistics:&lt;br /&gt;
 &lt;br /&gt;
    str   target     upper limits    van der Waals             RDCs&lt;br /&gt;
        function   #    rms   max   #    sum   max   #    rms   max&lt;br /&gt;
      1     8.98   5 0.0089  0.40  12   18.5  0.37  13 0.2508  2.27&lt;br /&gt;
      2     8.96   7 0.0083  0.31  15   17.4  0.38  19 0.2656  2.27&lt;br /&gt;
      3     9.69  11 0.0122  0.54  15   18.6  0.38  18 0.2595  2.28&lt;br /&gt;
      4     9.63   6 0.0068  0.20  16   18.9  0.38  18 0.2604  2.27&lt;br /&gt;
      5     9.41  14 0.0089  0.22  17   20.4  0.37  14 0.2521  2.26&lt;br /&gt;
      6     9.80  10 0.0085  0.24  17   19.7  0.38  15 0.2563  2.27&lt;br /&gt;
      7    10.52  12 0.0158  0.78  15   19.1  0.38  13 0.2554  2.29&lt;br /&gt;
      8    10.05  10 0.0084  0.18  18   20.3  0.42  18 0.2587  2.28&lt;br /&gt;
      9    10.57   7 0.0079  0.29  19   18.3  0.53  16 0.3169  2.43&lt;br /&gt;
     10    10.38  13 0.0088  0.21  22   20.5  0.37  21 0.2636  2.28&lt;br /&gt;
     11    10.33   7 0.0067  0.16  17   19.6  0.64  15 0.2663  2.28&lt;br /&gt;
     12     9.93   9 0.0090  0.29  19   20.6  0.38  20 0.2541  2.27&lt;br /&gt;
     13    10.12  12 0.0098  0.23  21   19.9  0.47  13 0.2681  2.30&lt;br /&gt;
     14    10.53   7 0.0077  0.19  23   19.3  0.38  11 0.3145  2.40&lt;br /&gt;
     15    10.96   8 0.0089  0.31  21   22.6  0.38  12 0.2639  2.28&lt;br /&gt;
     16    10.50  12 0.0100  0.29  23   20.1  0.37  15 0.2696  2.27&lt;br /&gt;
     17    10.56  14 0.0119  0.30  23   21.1  0.37  16 0.2736  2.33&lt;br /&gt;
     18    10.75  17 0.0146  0.60  21   20.0  0.37  12 0.2547  2.27&lt;br /&gt;
     19    10.88  18 0.0125  0.38  19   23.3  0.38  10 0.2506  2.30&lt;br /&gt;
     20    10.88   8 0.0083  0.26  23   21.4  0.42  15 0.2644  2.28&lt;br /&gt;
 &lt;br /&gt;
    Ave    10.17  10 0.0097  0.32  19   20.0  0.41  15 0.2660  2.29&lt;br /&gt;
    +/-     0.59   4 0.0024  0.15   3    1.4  0.07   3 0.0177  0.04&lt;br /&gt;
    Min     8.96   5 0.0067  0.16  12   17.4  0.37  10 0.2506  2.26&lt;br /&gt;
    Max    10.96  18 0.0158  0.78  23   23.3  0.64  21 0.3169  2.43&lt;br /&gt;
    Cut                      0.10             0.20             0.20&lt;br /&gt;
 &lt;br /&gt;
    Constraints violated in 6 or more structures:&lt;br /&gt;
                                                   #   mean   max.  1   5   10   15   20&lt;br /&gt;
    Upper HA    PRO   19 - HB3   ARG   20   5.50  15   0.11   0.21  +++++++  ++++   ++*+  peak 970&lt;br /&gt;
    Upper HA    ILE   23 - QB    SER   27   5.34   6   0.09   0.16         + ++   +  +*   peak 276&lt;br /&gt;
    Upper HA    ILE   30 - HB2   LEU   33   4.95  10   0.10   0.15      ++++  ++  ++ +*   peak 313&lt;br /&gt;
    VdW   CB    ALA   69 - H     THR   70   2.55  18   0.24   0.28  ++++++++ ++++ *+++++&lt;br /&gt;
    VdW   O     THR   71 - N     PHE   75   2.75  12   0.20   0.32   ++* +++  +   ++ +++&lt;br /&gt;
    VdW   O     PHE   75 - C     VAL   76   2.80  13   0.21   0.31      ++++ +  *+++++++&lt;br /&gt;
    VdW   CG1   VAL   76 - HG2   LYS   78   2.60   9   0.17   0.25   ++*   +++++   +&lt;br /&gt;
    VdW   HG3   LYS   78 - C     LYS   78   2.50  14   0.22   0.36  +++*++ +++++ + +  +&lt;br /&gt;
    Ori 1 N     ALA   69 - CA    ALA   69  -2.84  20   1.95   2.04  +++++++++++++*++++++&lt;br /&gt;
    Ori 1 H     ALA   69 - N     ALA   69  -3.32  20   2.01   2.33  ++++++++++++++++*+++&lt;br /&gt;
    Ori 1 N     THR   70 - C     ALA   69   0.25  16   0.31   1.06  ++++++++*+++ + +  ++&lt;br /&gt;
    Ori 1 H     ASN   79 - N     ASN   79  -4.71  10   0.17   0.32  + *+ +  ++++   +  +&lt;br /&gt;
    Ori 1 H     GLY   92 - N     GLY   92  -5.54   8   0.15   0.51     ++++*       +  ++&lt;br /&gt;
    Ori 1 H     LEU   94 - N     LEU   94   0.42   6   0.14   0.54   +*+     +++&lt;br /&gt;
    3 violated distance restraints.&lt;br /&gt;
    5 violated van der Waals restraints.&lt;br /&gt;
    6 violated residual dipolar coupling restraints.&lt;br /&gt;
 &lt;br /&gt;
 &lt;br /&gt;
    RDC statistics:&lt;br /&gt;
    Correlation coefficient     &amp;amp;nbsp;:    0.906 +/-  0.003    (0.899..0.909, best in conformer 4)&lt;br /&gt;
    Q = rms(Dcalc-Dobs)/rms(Dobs):   42.709 +/-  0.583&amp;amp;nbsp;%  (42.073..44.194)&lt;br /&gt;
    Q normalized by tensor      &amp;amp;nbsp;:   32.943 +/-  0.638&amp;amp;nbsp;%  (32.231..34.776)&lt;br /&gt;
    Alignment tensor magnitude  &amp;amp;nbsp;:    5.881 +/-  0.045 Hz (5.760..5.950, best 5.898; input 5.898)&lt;br /&gt;
    Alignment tensor rhombicity &amp;amp;nbsp;:    0.537 +/-  0.007    (0.524..0.556, best 0.539; input 0.539)&lt;br /&gt;
 &lt;br /&gt;
 &lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 14 Dec 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_Calculation_With_RDC%27s_Using_CYANA&amp;diff=3280</id>
		<title>Structure Calculation With RDC's Using CYANA</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_Calculation_With_RDC%27s_Using_CYANA&amp;diff=3280"/>
		<updated>2009-12-14T23:02:25Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
'''IMPORTANT DISCLAIMER:'''&amp;amp;nbsp;A number of NESG&amp;amp;nbsp;NMR groups are currently beta-testing sites for CYANA-3.0 and the information in this page is intended for use by the licensed members of the NESG consortium, other beta testers, and is to be used in accordance to the program licensing agreement. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The following page describes the setup and analysis using RDC&amp;amp;nbsp;constraints in the framework of CYANA-3.0.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
CYANA version 3.0 incorporates many new features including:&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
a) inclusion of residual dipolar coupling in structure calculation (RDC) &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
b) inclusion of pseudocontact shifts from paramagnetic centers in structure calculation (PCS)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
c) improved function for symmetric dimers and annotation of intermolecular NOE&amp;amp;nbsp;contacts in the peaklist using the xeasy color code notation. &amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Good agreement between global orientational constraints from RDC&amp;amp;nbsp;and distance information from NOEs is very important to achieve better structures by NMR. The program is an excellent step forward.&amp;amp;nbsp; Results should always be accompanied by energy refinement in CNS or NIH-XPLOR.&amp;amp;nbsp; Further information about the program and publication references can be found in the [http://www.cyana.org/wiki/index.php/Main_Page CYANA WIKI]&amp;amp;nbsp;page.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Automated NOE and RDC and Structure Calculation Setup &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The structure calculation with automated noesy assignments and RDC&amp;amp;nbsp;restraints follows the canonical CYANA&amp;amp;nbsp;recipe.&amp;amp;nbsp; Simple annealing calcualtions starting from a set of constraints that include RDC are easily derived by simplifying the scripts below and following the demo scripts. The program requires a sequence file (name.seq), a proton assignment list (name.prot), a noesy peaklist set (name.peaks), an RDC&amp;amp;nbsp;list (name.rdc), a CALC.cya script and an init.cya script.&amp;amp;nbsp;&amp;amp;nbsp; &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The sequence file now includes the RDC&amp;amp;nbsp;tensor origin separated by dummy linker residues: &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;MET      1&lt;br /&gt;
THR      2&lt;br /&gt;
SER      3&lt;br /&gt;
THR      4&lt;br /&gt;
PHE      5&lt;br /&gt;
ASP      6&lt;br /&gt;
ARG      7&lt;br /&gt;
VAL      8&lt;br /&gt;
ALA      9&lt;br /&gt;
THR     10&lt;br /&gt;
&lt;br /&gt;
PL     350&lt;br /&gt;
LL5    351&lt;br /&gt;
LL5    352&lt;br /&gt;
LL5    353&lt;br /&gt;
LL5    354&lt;br /&gt;
LL5    355&lt;br /&gt;
ORI    360&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The RDC&amp;amp;nbsp;list supports multiple interatomic vectors in multiple media. RDC&amp;amp;nbsp;with distinct scaling factors and distinct ORI&amp;amp;nbsp;residue numbers are listed in a single file. The program supports the Da (magnitude) and R (Rhombicity) notation typical of programs such as PALES, REDCAT etc. Below is a sample RDC file that includes N-H, N-CA (intra), and N-C' (sequential) vectors in one medium with appropriate errors and [http://www.ncbi.nlm.nih.gov/pubmed/18388951 scaling factors]:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Orientation  Magnitude  Rhombicity  ORI residue number&lt;br /&gt;
       1     5.39535        0.63125       360&lt;br /&gt;
#  First atom      Second atom                    RDC      Error  Weight  Orientation &lt;br /&gt;
     7    ARG      H       7    ARG     N        5.936     2.000   1.000  1&lt;br /&gt;
     8    VAL      H       8    VAL     N        3.827     2.000   1.000  1&lt;br /&gt;
     9    ALA      H       9    ALA     N       -2.822     2.000   1.000  1&lt;br /&gt;
    10    THR      H      10    THR     N       -0.674     2.000   1.000  1&lt;br /&gt;
    11    ILE      H      11    ILE     N        4.945     2.000   1.000  1&lt;br /&gt;
    12    ILE      H      12    ILE     N        1.709     2.000   1.000  1&lt;br /&gt;
    13    ALA      H      13    ALA     N       -1.336     2.000   1.000  1&lt;br /&gt;
#&lt;br /&gt;
    4     THR      N       3    SER     C        1.267     0.095   8.330  1&lt;br /&gt;
    5     PHE      N       4    THR     C       -0.246     0.207   8.330  1   &lt;br /&gt;
    7     ARG      N       6    ASP     C        0.161     0.052   8.330  1   &lt;br /&gt;
    8     VAL      N       7    ARG     C        0.439     0.034   8.330  1   &lt;br /&gt;
    9     ALA      N       8    VAL     C       -0.076     0.040   8.330  1   &lt;br /&gt;
   10     THR      N       9    ALA     C       -0.957     0.048   8.330  1   &lt;br /&gt;
   11     ILE      N      10    THR     C        1.123     0.022   8.330  1   &lt;br /&gt;
   12     ILE      N      11    ILE     C       -0.440     0.037   8.330  1   &lt;br /&gt;
   13     ALA      N      12    ILE     C        0.065     0.026   8.330  1   &lt;br /&gt;
#&lt;br /&gt;
    3     SER      N      3     SER    CA        0.251     0.199   8.330  1&lt;br /&gt;
    4     THR      N      4     THR    CA       -0.265     0.258   8.330  1&lt;br /&gt;
    5     PHE      N      5     PHE    CA       -0.499     0.281   8.330  1&lt;br /&gt;
    7     ARG      N      7     ARG    CA       -0.457     0.200   8.330  1&lt;br /&gt;
    8     VAL      N      8     VAL    CA       -0.481     0.154   8.330  1&lt;br /&gt;
    9     ALA      N      9     ALA    CA        0.349     0.083   8.330  1&lt;br /&gt;
   10     THR      N     10     THR    CA        0.548     0.121   8.330  1&lt;br /&gt;
   11     ILE      N     11     ILE    CA       -0.091     0.111   8.330  1&lt;br /&gt;
   12     ILE      N     12     ILE    CA       -0.678     0.078   8.330  1&lt;br /&gt;
   13     ALA      N     13     ALA    CA        1.014     0.108   8.330  1&amp;lt;/pre&amp;gt; &lt;br /&gt;
Multiple media (e.g. orientations) should be listed as follows: &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Orientation  Magnitude  Rhombicity  ORI residue number&lt;br /&gt;
       1     5.39535        0.63125       360&lt;br /&gt;
       2     7.55656        0.58200       370&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
and the sequence should be modified to include further links and ORI:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;ALA      9&lt;br /&gt;
THR     10&lt;br /&gt;
&lt;br /&gt;
PL     350&lt;br /&gt;
LL5    351&lt;br /&gt;
LL5    352&lt;br /&gt;
LL5    353&lt;br /&gt;
LL5    354&lt;br /&gt;
LL5    355&lt;br /&gt;
ORI    360&lt;br /&gt;
LL5    361&lt;br /&gt;
LL5    362&lt;br /&gt;
LL5    363&lt;br /&gt;
LL5    364&lt;br /&gt;
LL5    365&lt;br /&gt;
ORI    370&amp;lt;/pre&amp;gt; &lt;br /&gt;
If the values of Da and R are not known they can be determined using any desired software OR&amp;amp;nbsp;using the FindTensor.cya script below. The program yields results that are equivalent to PALES assiuming the same fitting method is employed.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;## 8DEMOS: FindTensor - Determine alignment tensor&lt;br /&gt;
##&lt;br /&gt;
## Determine magnitude and rhombicity of the alignment tensor&lt;br /&gt;
## from input RDCs&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
# determine tensor from histogram, no structure needed&lt;br /&gt;
&lt;br /&gt;
read rdc phage_all_mono.rdc&lt;br /&gt;
print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Input alignment tensor:&amp;quot;&lt;br /&gt;
do i 1 orientations&lt;br /&gt;
&amp;amp;nbsp; print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Orientation $i: magnitude = $magnitude(i) Hz, rhombicity = $rhombicity(i).&amp;quot;&lt;br /&gt;
end do&lt;br /&gt;
&lt;br /&gt;
rdc fittensor method=simplex&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; # (can take several minutes)&lt;br /&gt;
#rdc fittensor method=gridsearch&amp;amp;nbsp;&amp;amp;nbsp; # systematic search (very slow)&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
# alternatively, determine tensor from given structure by SVD&lt;br /&gt;
&lt;br /&gt;
read rdc phage_all_mono.rdc&lt;br /&gt;
read pdb final.pdb&lt;br /&gt;
overview&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The dummy values in the rdc list are read initially and they can be updated after running the FindTensor.cya routine. If no models are present (e.g. final.pdb) the program will terminate with a warning. &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The working directory that contains all the files necessary to start the calcualtion is ready and the CALC.cya modified for the presence of RDC constraints is used:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;peaks      &amp;amp;nbsp;:= ali5.peaks,aro5.peaks,n3.peaks  # names of NOESY peak lists&lt;br /&gt;
prot       &amp;amp;nbsp;:= RpR324.prot               # names of chemical shift lists&lt;br /&gt;
restraints &amp;amp;nbsp;:= ssa.cya,phage_all_mono.rdc # additional (non-NOE) constraints&lt;br /&gt;
tolerance  &amp;amp;nbsp;:= 0.04,0.025,0.3            # chemical shift tolerances: HX2-HX1-X1&lt;br /&gt;
calibration&amp;amp;nbsp;:=                           # NOE calibration parameters&lt;br /&gt;
structures &amp;amp;nbsp;:= 100,20                    # number of initial, final structures&lt;br /&gt;
steps      &amp;amp;nbsp;:= 10000                     # number of torsion angle dynamics steps&lt;br /&gt;
rmsdrange  &amp;amp;nbsp;:= 10..80                    # residue range for RMSD calculation&lt;br /&gt;
randomseed &amp;amp;nbsp;:= 56231       # random number generator seed&lt;br /&gt;
&lt;br /&gt;
weight_rdc   = 0.02               # weight for RDC restraints&lt;br /&gt;
cut_rdc      = 0.2                # cutoff for RDC violation output&lt;br /&gt;
&lt;br /&gt;
ssa&lt;br /&gt;
noeassign peaks=$peaks prot=$prot autoaco&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
Notice the restraint contain the forced stereospecifically assigned methyls and sidechain NH's and the RDC&amp;amp;nbsp;set.&amp;amp;nbsp; Also, the NOE vs. RDC&amp;amp;nbsp;weight is set by the weight_rdc and cut_rdc functions. The remaining instructions are identical to the CYANA-2.1 file.&amp;amp;nbsp; Further parameters are specified in the init.cya file below:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;name:=RpR324&lt;br /&gt;
rmsdrange:=10-80&lt;br /&gt;
cyanalib&lt;br /&gt;
nproc:=8&lt;br /&gt;
read seq $name.seq&lt;br /&gt;
rdcdistances&amp;lt;/pre&amp;gt; &lt;br /&gt;
The above script is intended to run off a single dual-quad core machine (nproc=8).&amp;amp;nbsp; Please note the rdcdistance.cya macro is being called by the init.cya setup file.&amp;amp;nbsp; This file, located in the cyana-3.0/macro directory contains the supported RDC&amp;amp;nbsp;vectors, more vectors could potentially be added such as Trp NE1-HE1 that maybe useful in deuterated sample to direct the large hydrophobic sidechain.&amp;amp;nbsp; &amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;# Copyright (c) 2002-08 Peter Guntert. All rights reserved.&lt;br /&gt;
## 7MACROS: rdcdistances - CYANA macro&lt;br /&gt;
##&lt;br /&gt;
## Parameters: (none)&lt;br /&gt;
##&lt;br /&gt;
# dipole definition format: atom1_name atom2_name atom1_index atom2_index&lt;br /&gt;
# if indexes are missing, zeros are assumed&lt;br /&gt;
&lt;br /&gt;
var info echo&lt;br /&gt;
&lt;br /&gt;
syntax&lt;br /&gt;
&lt;br /&gt;
info:=none; echo:=off&lt;br /&gt;
rdc distance &amp;quot;N&amp;amp;nbsp; H&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.041&lt;br /&gt;
rdc distance &amp;quot;CA HA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.117&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; CA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.525&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; N&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.461&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; N -1&amp;quot; distance=1.329&lt;br /&gt;
rdc distance &amp;quot;CA N&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.458&lt;br /&gt;
rdc distance &amp;quot;CA N -1&amp;quot; distance=2.425&lt;br /&gt;
rdc distance &amp;quot;CA H&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.117&lt;br /&gt;
rdc distance &amp;quot;CA H -1&amp;quot; distance=2.533&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; H -1&amp;quot; distance=2.000&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; HA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.144&lt;br /&gt;
rdc distance &amp;quot;CB HB&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.080&lt;br /&gt;
rdc distance &amp;quot;CA CB&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.532&lt;br /&gt;
unset info&lt;br /&gt;
print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Standard RDC distances defined.&amp;quot;&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The command line execution form single machine or cluster using MPI implememntation (highly recommended) is carried on as usual:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/cyana-3.0/cyana CALC &amp;amp;gt; &amp;amp;amp; log &amp;amp;amp;&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
the MPI&amp;amp;nbsp;is launched using the script called, for example, submit_cyana:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;#!/bin/bash&lt;br /&gt;
#PBS -S /bin/bash&lt;br /&gt;
#PBS -N cyana&lt;br /&gt;
#PBS -lnodes=6:ppn=8&lt;br /&gt;
lamboot ~/bhost.def&lt;br /&gt;
cd /farm/users/prossi/RpR324_structure/cyana_new_mono2&lt;br /&gt;
/opt/openmpi/tcp-gnu/bin/mpirun /farm/software/cyana-3.0-mpi/cyana CALC.cya&lt;br /&gt;
lamhalt&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt;with the command:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;qsub -q @master3 submit_cyana&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
The starting scripts are highly system specific they are almost guaranteed NOT&amp;amp;nbsp;to work on your sytem and are given here for general information only. &amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Output analysis &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The output analysis is carried out in the usual manner, it should be noted that, during the calculation the specified values Da and R are kept fixed.&amp;amp;nbsp; Following the final cycle a new model-based estimate of Da and R&amp;amp;nbsp;is calculated and used to compute the RDC violations and their contribution to the target function and the quality factor (Q). The resulting target function will be increased by the number and extent of RDC&amp;amp;nbsp;violations in addition to other violations from dihedral, vdw, and NOEs restraints. &lt;br /&gt;
&lt;br /&gt;
A partial output file is given below (final.ovw):&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt; &lt;br /&gt;
    Structural statistics:&lt;br /&gt;
 &lt;br /&gt;
    str   target     upper limits    van der Waals             RDCs&lt;br /&gt;
        function   #    rms   max   #    sum   max   #    rms   max&lt;br /&gt;
      1     8.98   5 0.0089  0.40  12   18.5  0.37  13 0.2508  2.27&lt;br /&gt;
      2     8.96   7 0.0083  0.31  15   17.4  0.38  19 0.2656  2.27&lt;br /&gt;
      3     9.69  11 0.0122  0.54  15   18.6  0.38  18 0.2595  2.28&lt;br /&gt;
      4     9.63   6 0.0068  0.20  16   18.9  0.38  18 0.2604  2.27&lt;br /&gt;
      5     9.41  14 0.0089  0.22  17   20.4  0.37  14 0.2521  2.26&lt;br /&gt;
      6     9.80  10 0.0085  0.24  17   19.7  0.38  15 0.2563  2.27&lt;br /&gt;
      7    10.52  12 0.0158  0.78  15   19.1  0.38  13 0.2554  2.29&lt;br /&gt;
      8    10.05  10 0.0084  0.18  18   20.3  0.42  18 0.2587  2.28&lt;br /&gt;
      9    10.57   7 0.0079  0.29  19   18.3  0.53  16 0.3169  2.43&lt;br /&gt;
     10    10.38  13 0.0088  0.21  22   20.5  0.37  21 0.2636  2.28&lt;br /&gt;
     11    10.33   7 0.0067  0.16  17   19.6  0.64  15 0.2663  2.28&lt;br /&gt;
     12     9.93   9 0.0090  0.29  19   20.6  0.38  20 0.2541  2.27&lt;br /&gt;
     13    10.12  12 0.0098  0.23  21   19.9  0.47  13 0.2681  2.30&lt;br /&gt;
     14    10.53   7 0.0077  0.19  23   19.3  0.38  11 0.3145  2.40&lt;br /&gt;
     15    10.96   8 0.0089  0.31  21   22.6  0.38  12 0.2639  2.28&lt;br /&gt;
     16    10.50  12 0.0100  0.29  23   20.1  0.37  15 0.2696  2.27&lt;br /&gt;
     17    10.56  14 0.0119  0.30  23   21.1  0.37  16 0.2736  2.33&lt;br /&gt;
     18    10.75  17 0.0146  0.60  21   20.0  0.37  12 0.2547  2.27&lt;br /&gt;
     19    10.88  18 0.0125  0.38  19   23.3  0.38  10 0.2506  2.30&lt;br /&gt;
     20    10.88   8 0.0083  0.26  23   21.4  0.42  15 0.2644  2.28&lt;br /&gt;
 &lt;br /&gt;
    Ave    10.17  10 0.0097  0.32  19   20.0  0.41  15 0.2660  2.29&lt;br /&gt;
    +/-     0.59   4 0.0024  0.15   3    1.4  0.07   3 0.0177  0.04&lt;br /&gt;
    Min     8.96   5 0.0067  0.16  12   17.4  0.37  10 0.2506  2.26&lt;br /&gt;
    Max    10.96  18 0.0158  0.78  23   23.3  0.64  21 0.3169  2.43&lt;br /&gt;
    Cut                      0.10             0.20             0.20&lt;br /&gt;
 &lt;br /&gt;
    Constraints violated in 6 or more structures:&lt;br /&gt;
                                                   #   mean   max.  1   5   10   15   20&lt;br /&gt;
    Upper HA    PRO   19 - HB3   ARG   20   5.50  15   0.11   0.21  +++++++  ++++   ++*+  peak 970&lt;br /&gt;
    Upper HA    ILE   23 - QB    SER   27   5.34   6   0.09   0.16         + ++   +  +*   peak 276&lt;br /&gt;
    Upper HA    ILE   30 - HB2   LEU   33   4.95  10   0.10   0.15      ++++  ++  ++ +*   peak 313&lt;br /&gt;
    VdW   CB    ALA   69 - H     THR   70   2.55  18   0.24   0.28  ++++++++ ++++ *+++++&lt;br /&gt;
    VdW   O     THR   71 - N     PHE   75   2.75  12   0.20   0.32   ++* +++  +   ++ +++&lt;br /&gt;
    VdW   O     PHE   75 - C     VAL   76   2.80  13   0.21   0.31      ++++ +  *+++++++&lt;br /&gt;
    VdW   CG1   VAL   76 - HG2   LYS   78   2.60   9   0.17   0.25   ++*   +++++   +&lt;br /&gt;
    VdW   HG3   LYS   78 - C     LYS   78   2.50  14   0.22   0.36  +++*++ +++++ + +  +&lt;br /&gt;
    Ori 1 N     ALA   69 - CA    ALA   69  -2.84  20   1.95   2.04  +++++++++++++*++++++&lt;br /&gt;
    Ori 1 H     ALA   69 - N     ALA   69  -3.32  20   2.01   2.33  ++++++++++++++++*+++&lt;br /&gt;
    Ori 1 N     THR   70 - C     ALA   69   0.25  16   0.31   1.06  ++++++++*+++ + +  ++&lt;br /&gt;
    Ori 1 H     ASN   79 - N     ASN   79  -4.71  10   0.17   0.32  + *+ +  ++++   +  +&lt;br /&gt;
    Ori 1 H     GLY   92 - N     GLY   92  -5.54   8   0.15   0.51     ++++*       +  ++&lt;br /&gt;
    Ori 1 H     LEU   94 - N     LEU   94   0.42   6   0.14   0.54   +*+     +++&lt;br /&gt;
    3 violated distance restraints.&lt;br /&gt;
    5 violated van der Waals restraints.&lt;br /&gt;
    6 violated residual dipolar coupling restraints.&lt;br /&gt;
 &lt;br /&gt;
 &lt;br /&gt;
    RDC statistics:&lt;br /&gt;
    Correlation coefficient     &amp;amp;nbsp;:    0.906 +/-  0.003    (0.899..0.909, best in conformer 4)&lt;br /&gt;
    Q = rms(Dcalc-Dobs)/rms(Dobs):   42.709 +/-  0.583&amp;amp;nbsp;%  (42.073..44.194)&lt;br /&gt;
    Q normalized by tensor      &amp;amp;nbsp;:   32.943 +/-  0.638&amp;amp;nbsp;%  (32.231..34.776)&lt;br /&gt;
    Alignment tensor magnitude  &amp;amp;nbsp;:    5.881 +/-  0.045 Hz (5.760..5.950, best 5.898; input 5.898)&lt;br /&gt;
    Alignment tensor rhombicity &amp;amp;nbsp;:    0.537 +/-  0.007    (0.524..0.556, best 0.539; input 0.539)&lt;br /&gt;
 &lt;br /&gt;
 &lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 14 Dec 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_Calculation_With_RDC%27s_Using_CYANA&amp;diff=3279</id>
		<title>Structure Calculation With RDC's Using CYANA</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_Calculation_With_RDC%27s_Using_CYANA&amp;diff=3279"/>
		<updated>2009-12-14T23:00:02Z</updated>

		<summary type="html">&lt;p&gt;Prossi: Created page with '== '''Introduction'''  ==  '''IMPORTANT DISCLAIMER:'''&amp;amp;nbsp;A number of NESG&amp;amp;nbsp;NMR groups are currently beta-testing sites for CYANA-3.0 and the information in this page is in…'&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
'''IMPORTANT DISCLAIMER:'''&amp;amp;nbsp;A number of NESG&amp;amp;nbsp;NMR groups are currently beta-testing sites for CYANA-3.0 and the information in this page is intended for use by the licensed members of the NESG consortium, other beta testers, and is to be used in accordance to the program licensing agreement.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
The following page describes the setup and analysis using RDC&amp;amp;nbsp;constraints in the framework of CYANA-3.0.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
CYANA version 3.0 incorporates many new features including:&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
a) inclusion of residual dipolar coupling in structure calculation (RDC) &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
b) inclusion of pseudocontact shifts from paramagnetic centers in structure calculation (PCS)&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
c) improved function for symmetric dimers and annotation of intermolecular NOE&amp;amp;nbsp;contacts in the peaklist using the xeasy color code notation. &amp;amp;nbsp;&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
Good agreement between global orientational constraints from RDC&amp;amp;nbsp;and distance information from NOEs is very important to achieve better structures by NMR. The program is an excellent step forward.&amp;amp;nbsp; Results should always be accompanied by energy refinement in CNS or NIH-XPLOR.&amp;amp;nbsp; Further information about the program and publication references can be found in the [http://www.cyana.org/wiki/index.php/Main_Page CYANA WIKI]&amp;amp;nbsp;page.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Automated NOE and RDC and Structure Calculation Setup &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The structure calculation with automated noesy assignments and RDC&amp;amp;nbsp;restraints follows the canonical CYANA&amp;amp;nbsp;recipe.&amp;amp;nbsp; Simple annealing calcualtions starting from a set of constraints that include RDC are easily derived by simplifying the scripts below and following the demo scripts. The program requires a sequence file (name.seq), a proton assignment list (name.prot), a noesy peaklist set (name.peaks), an RDC&amp;amp;nbsp;list (name.rdc), a CALC.cya script and an init.cya script.&amp;amp;nbsp;&amp;amp;nbsp; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
The sequence file now includes the RDC&amp;amp;nbsp;tensor origin separated by dummy linker residues: &amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;MET      1&lt;br /&gt;
THR      2&lt;br /&gt;
SER      3&lt;br /&gt;
THR      4&lt;br /&gt;
PHE      5&lt;br /&gt;
ASP      6&lt;br /&gt;
ARG      7&lt;br /&gt;
VAL      8&lt;br /&gt;
ALA      9&lt;br /&gt;
THR     10&lt;br /&gt;
&lt;br /&gt;
PL     350&lt;br /&gt;
LL5    351&lt;br /&gt;
LL5    352&lt;br /&gt;
LL5    353&lt;br /&gt;
LL5    354&lt;br /&gt;
LL5    355&lt;br /&gt;
ORI    360&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
The RDC&amp;amp;nbsp;list supports multiple interatomic vectors in multiple media. RDC&amp;amp;nbsp;with distinct scaling factors and distinct ORI&amp;amp;nbsp;residue numbers are listed in a single file. The program supports the Da (magnitude) and R (Rhombicity) notation typical of programs such as PALES, REDCAT etc. Below is a sample RDC file that includes N-H, N-CA (intra), and N-C' (sequential) vectors in one medium with appropriate errors and [http://www.ncbi.nlm.nih.gov/pubmed/18388951 scaling factors]:&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;# Orientation  Magnitude  Rhombicity  ORI residue number&lt;br /&gt;
       1     5.39535        0.63125       360&lt;br /&gt;
#  First atom      Second atom                    RDC      Error  Weight  Orientation &lt;br /&gt;
     7    ARG      H       7    ARG     N        5.936     2.000   1.000  1&lt;br /&gt;
     8    VAL      H       8    VAL     N        3.827     2.000   1.000  1&lt;br /&gt;
     9    ALA      H       9    ALA     N       -2.822     2.000   1.000  1&lt;br /&gt;
    10    THR      H      10    THR     N       -0.674     2.000   1.000  1&lt;br /&gt;
    11    ILE      H      11    ILE     N        4.945     2.000   1.000  1&lt;br /&gt;
    12    ILE      H      12    ILE     N        1.709     2.000   1.000  1&lt;br /&gt;
    13    ALA      H      13    ALA     N       -1.336     2.000   1.000  1&lt;br /&gt;
#&lt;br /&gt;
    4     THR      N       3    SER     C        1.267     0.095   8.330  1&lt;br /&gt;
    5     PHE      N       4    THR     C       -0.246     0.207   8.330  1   &lt;br /&gt;
    7     ARG      N       6    ASP     C        0.161     0.052   8.330  1   &lt;br /&gt;
    8     VAL      N       7    ARG     C        0.439     0.034   8.330  1   &lt;br /&gt;
    9     ALA      N       8    VAL     C       -0.076     0.040   8.330  1   &lt;br /&gt;
   10     THR      N       9    ALA     C       -0.957     0.048   8.330  1   &lt;br /&gt;
   11     ILE      N      10    THR     C        1.123     0.022   8.330  1   &lt;br /&gt;
   12     ILE      N      11    ILE     C       -0.440     0.037   8.330  1   &lt;br /&gt;
   13     ALA      N      12    ILE     C        0.065     0.026   8.330  1   &lt;br /&gt;
#&lt;br /&gt;
    3     SER      N      3     SER    CA        0.251     0.199   8.330  1&lt;br /&gt;
    4     THR      N      4     THR    CA       -0.265     0.258   8.330  1&lt;br /&gt;
    5     PHE      N      5     PHE    CA       -0.499     0.281   8.330  1&lt;br /&gt;
    7     ARG      N      7     ARG    CA       -0.457     0.200   8.330  1&lt;br /&gt;
    8     VAL      N      8     VAL    CA       -0.481     0.154   8.330  1&lt;br /&gt;
    9     ALA      N      9     ALA    CA        0.349     0.083   8.330  1&lt;br /&gt;
   10     THR      N     10     THR    CA        0.548     0.121   8.330  1&lt;br /&gt;
   11     ILE      N     11     ILE    CA       -0.091     0.111   8.330  1&lt;br /&gt;
   12     ILE      N     12     ILE    CA       -0.678     0.078   8.330  1&lt;br /&gt;
   13     ALA      N     13     ALA    CA        1.014     0.108   8.330  1&amp;lt;/pre&amp;gt;&lt;br /&gt;
Multiple media (e.g. orientations) should be listed as follows: &amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;# Orientation  Magnitude  Rhombicity  ORI residue number&lt;br /&gt;
       1     5.39535        0.63125       360&lt;br /&gt;
       2     7.55656        0.58200       370&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
and the sequence should be modified to include further links and ORI:&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;ALA      9&lt;br /&gt;
THR     10&lt;br /&gt;
&lt;br /&gt;
PL     350&lt;br /&gt;
LL5    351&lt;br /&gt;
LL5    352&lt;br /&gt;
LL5    353&lt;br /&gt;
LL5    354&lt;br /&gt;
LL5    355&lt;br /&gt;
ORI    360&lt;br /&gt;
LL5    361&lt;br /&gt;
LL5    362&lt;br /&gt;
LL5    363&lt;br /&gt;
LL5    364&lt;br /&gt;
LL5    365&lt;br /&gt;
ORI    370&amp;lt;/pre&amp;gt;&lt;br /&gt;
If the values of Da and R are not known they can be determined using any desired software OR&amp;amp;nbsp;using the FindTensor.cya script below. The program yields results that are equivalent to PALES assiuming the same fitting method is employed.&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;## 8DEMOS: FindTensor - Determine alignment tensor&lt;br /&gt;
##&lt;br /&gt;
## Determine magnitude and rhombicity of the alignment tensor&lt;br /&gt;
## from input RDCs&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
# determine tensor from histogram, no structure needed&lt;br /&gt;
&lt;br /&gt;
read rdc phage_all_mono.rdc&lt;br /&gt;
print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Input alignment tensor:&amp;quot;&lt;br /&gt;
do i 1 orientations&lt;br /&gt;
&amp;amp;nbsp; print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Orientation $i: magnitude = $magnitude(i) Hz, rhombicity = $rhombicity(i).&amp;quot;&lt;br /&gt;
end do&lt;br /&gt;
&lt;br /&gt;
rdc fittensor method=simplex&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; # (can take several minutes)&lt;br /&gt;
#rdc fittensor method=gridsearch&amp;amp;nbsp;&amp;amp;nbsp; # systematic search (very slow)&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
# alternatively, determine tensor from given structure by SVD&lt;br /&gt;
&lt;br /&gt;
read rdc phage_all_mono.rdc&lt;br /&gt;
read pdb final.pdb&lt;br /&gt;
overview&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
The dummy values in the rdc list are read initially and they can be updated after running the FindTensor.cya routine. If no models are present (e.g. final.pdb) the program will terminate with a warning. &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
The working directory that contains all the files necessary to start the calcualtion is ready and the CALC.cya modified for the presence of RDC constraints is used:&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;peaks       := ali5.peaks,aro5.peaks,n3.peaks  # names of NOESY peak lists&lt;br /&gt;
prot        := RpR324.prot               # names of chemical shift lists&lt;br /&gt;
restraints  := ssa.cya,phage_all_mono.rdc # additional (non-NOE) constraints&lt;br /&gt;
tolerance   := 0.04,0.025,0.3            # chemical shift tolerances: HX2-HX1-X1&lt;br /&gt;
calibration :=                           # NOE calibration parameters&lt;br /&gt;
structures  := 100,20                    # number of initial, final structures&lt;br /&gt;
steps       := 10000                     # number of torsion angle dynamics steps&lt;br /&gt;
rmsdrange   := 10..80                    # residue range for RMSD calculation&lt;br /&gt;
randomseed  := 56231       # random number generator seed&lt;br /&gt;
&lt;br /&gt;
weight_rdc   = 0.02               # weight for RDC restraints&lt;br /&gt;
cut_rdc      = 0.2                # cutoff for RDC violation output&lt;br /&gt;
&lt;br /&gt;
ssa&lt;br /&gt;
noeassign peaks=$peaks prot=$prot autoaco&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
Notice the restraint contain the forced stereospecifically assigned methyls and sidechain NH's and the RDC&amp;amp;nbsp;set.&amp;amp;nbsp; Also, the NOE vs. RDC&amp;amp;nbsp;weight is set by the weight_rdc and cut_rdc functions. The remaining instructions are identical to the CYANA-2.1 file.&amp;amp;nbsp; Further parameters are specified in the init.cya file below:&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;name:=RpR324&lt;br /&gt;
rmsdrange:=10-80&lt;br /&gt;
cyanalib&lt;br /&gt;
nproc:=8&lt;br /&gt;
read seq $name.seq&lt;br /&gt;
rdcdistances&amp;lt;/pre&amp;gt;&lt;br /&gt;
The above script is intended to run off a single dual-quad core machine (nproc=8).&amp;amp;nbsp; Please note the rdcdistance.cya macro is being called by the init.cya setup file.&amp;amp;nbsp; This file, located in the cyana-3.0/macro directory contains the supported RDC&amp;amp;nbsp;vectors, more vectors could potentially be added such as Trp NE1-HE1 that maybe useful in deuterated sample to direct the large hydrophobic sidechain.&amp;amp;nbsp; &amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;# Copyright (c) 2002-08 Peter Guntert. All rights reserved.&lt;br /&gt;
## 7MACROS: rdcdistances - CYANA macro&lt;br /&gt;
##&lt;br /&gt;
## Parameters: (none)&lt;br /&gt;
##&lt;br /&gt;
# dipole definition format: atom1_name atom2_name atom1_index atom2_index&lt;br /&gt;
# if indexes are missing, zeros are assumed&lt;br /&gt;
&lt;br /&gt;
var info echo&lt;br /&gt;
&lt;br /&gt;
syntax&lt;br /&gt;
&lt;br /&gt;
info:=none; echo:=off&lt;br /&gt;
rdc distance &amp;quot;N&amp;amp;nbsp; H&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.041&lt;br /&gt;
rdc distance &amp;quot;CA HA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.117&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; CA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.525&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; N&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.461&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; N -1&amp;quot; distance=1.329&lt;br /&gt;
rdc distance &amp;quot;CA N&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.458&lt;br /&gt;
rdc distance &amp;quot;CA N -1&amp;quot; distance=2.425&lt;br /&gt;
rdc distance &amp;quot;CA H&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.117&lt;br /&gt;
rdc distance &amp;quot;CA H -1&amp;quot; distance=2.533&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; H -1&amp;quot; distance=2.000&lt;br /&gt;
rdc distance &amp;quot;C&amp;amp;nbsp; HA&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=2.144&lt;br /&gt;
rdc distance &amp;quot;CB HB&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.080&lt;br /&gt;
rdc distance &amp;quot;CA CB&amp;quot;&amp;amp;nbsp;&amp;amp;nbsp; distance=1.532&lt;br /&gt;
unset info&lt;br /&gt;
print &amp;quot;&amp;amp;nbsp;&amp;amp;nbsp;&amp;amp;nbsp; Standard RDC distances defined.&amp;quot;&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
The command line execution form single machine or cluster using MPI implememntation (highly recommended) is carried on as usual:&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;/cyana-3.0/cyana CALC &amp;amp;gt; &amp;amp;amp; log &amp;amp;amp;&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
the MPI&amp;amp;nbsp;is launched using the script called, for example, submit_cyana:&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;#!/bin/bash&lt;br /&gt;
#PBS -S /bin/bash&lt;br /&gt;
#PBS -N cyana&lt;br /&gt;
#PBS -lnodes=6:ppn=8&lt;br /&gt;
lamboot ~/bhost.def&lt;br /&gt;
cd /farm/users/prossi/RpR324_structure/cyana_new_mono2&lt;br /&gt;
/opt/openmpi/tcp-gnu/bin/mpirun /farm/software/cyana-3.0-mpi/cyana CALC.cya&lt;br /&gt;
lamhalt&amp;lt;/pre&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;with the command:&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;qsub -q @master3 submit_cyana&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
The starting scripts are highly system specific they are almost guaranteed NOT&amp;amp;nbsp;to work on your sytem and are given here for general information only. &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span style=&amp;quot;font-weight: bold;&amp;quot;&amp;gt;Output analysis &amp;lt;/span&amp;gt;&amp;lt;br&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
The output analysis is carried out in the usual manner, it should be noted that, during the calculation the specified values Da and R are kept fixed.&amp;amp;nbsp; Following the final cycle a new model-based estimate of Da and R&amp;amp;nbsp;is calculated and used to compute the RDC violations and their contribution to the target function. The resulting target function will be increased by the number and extent of RDC&amp;amp;nbsp;violations in addition to other violations from dihedral, vdw, and NOEs restraints. &lt;br /&gt;
&lt;br /&gt;
A partial output file is given below (final.ovw):&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt; &lt;br /&gt;
    Structural statistics:&lt;br /&gt;
 &lt;br /&gt;
    str   target     upper limits    van der Waals             RDCs&lt;br /&gt;
        function   #    rms   max   #    sum   max   #    rms   max&lt;br /&gt;
      1     8.98   5 0.0089  0.40  12   18.5  0.37  13 0.2508  2.27&lt;br /&gt;
      2     8.96   7 0.0083  0.31  15   17.4  0.38  19 0.2656  2.27&lt;br /&gt;
      3     9.69  11 0.0122  0.54  15   18.6  0.38  18 0.2595  2.28&lt;br /&gt;
      4     9.63   6 0.0068  0.20  16   18.9  0.38  18 0.2604  2.27&lt;br /&gt;
      5     9.41  14 0.0089  0.22  17   20.4  0.37  14 0.2521  2.26&lt;br /&gt;
      6     9.80  10 0.0085  0.24  17   19.7  0.38  15 0.2563  2.27&lt;br /&gt;
      7    10.52  12 0.0158  0.78  15   19.1  0.38  13 0.2554  2.29&lt;br /&gt;
      8    10.05  10 0.0084  0.18  18   20.3  0.42  18 0.2587  2.28&lt;br /&gt;
      9    10.57   7 0.0079  0.29  19   18.3  0.53  16 0.3169  2.43&lt;br /&gt;
     10    10.38  13 0.0088  0.21  22   20.5  0.37  21 0.2636  2.28&lt;br /&gt;
     11    10.33   7 0.0067  0.16  17   19.6  0.64  15 0.2663  2.28&lt;br /&gt;
     12     9.93   9 0.0090  0.29  19   20.6  0.38  20 0.2541  2.27&lt;br /&gt;
     13    10.12  12 0.0098  0.23  21   19.9  0.47  13 0.2681  2.30&lt;br /&gt;
     14    10.53   7 0.0077  0.19  23   19.3  0.38  11 0.3145  2.40&lt;br /&gt;
     15    10.96   8 0.0089  0.31  21   22.6  0.38  12 0.2639  2.28&lt;br /&gt;
     16    10.50  12 0.0100  0.29  23   20.1  0.37  15 0.2696  2.27&lt;br /&gt;
     17    10.56  14 0.0119  0.30  23   21.1  0.37  16 0.2736  2.33&lt;br /&gt;
     18    10.75  17 0.0146  0.60  21   20.0  0.37  12 0.2547  2.27&lt;br /&gt;
     19    10.88  18 0.0125  0.38  19   23.3  0.38  10 0.2506  2.30&lt;br /&gt;
     20    10.88   8 0.0083  0.26  23   21.4  0.42  15 0.2644  2.28&lt;br /&gt;
 &lt;br /&gt;
    Ave    10.17  10 0.0097  0.32  19   20.0  0.41  15 0.2660  2.29&lt;br /&gt;
    +/-     0.59   4 0.0024  0.15   3    1.4  0.07   3 0.0177  0.04&lt;br /&gt;
    Min     8.96   5 0.0067  0.16  12   17.4  0.37  10 0.2506  2.26&lt;br /&gt;
    Max    10.96  18 0.0158  0.78  23   23.3  0.64  21 0.3169  2.43&lt;br /&gt;
    Cut                      0.10             0.20             0.20&lt;br /&gt;
 &lt;br /&gt;
    Constraints violated in 6 or more structures:&lt;br /&gt;
                                                   #   mean   max.  1   5   10   15   20&lt;br /&gt;
    Upper HA    PRO   19 - HB3   ARG   20   5.50  15   0.11   0.21  +++++++  ++++   ++*+  peak 970&lt;br /&gt;
    Upper HA    ILE   23 - QB    SER   27   5.34   6   0.09   0.16         + ++   +  +*   peak 276&lt;br /&gt;
    Upper HA    ILE   30 - HB2   LEU   33   4.95  10   0.10   0.15      ++++  ++  ++ +*   peak 313&lt;br /&gt;
    VdW   CB    ALA   69 - H     THR   70   2.55  18   0.24   0.28  ++++++++ ++++ *+++++&lt;br /&gt;
    VdW   O     THR   71 - N     PHE   75   2.75  12   0.20   0.32   ++* +++  +   ++ +++&lt;br /&gt;
    VdW   O     PHE   75 - C     VAL   76   2.80  13   0.21   0.31      ++++ +  *+++++++&lt;br /&gt;
    VdW   CG1   VAL   76 - HG2   LYS   78   2.60   9   0.17   0.25   ++*   +++++   +&lt;br /&gt;
    VdW   HG3   LYS   78 - C     LYS   78   2.50  14   0.22   0.36  +++*++ +++++ + +  +&lt;br /&gt;
    Ori 1 N     ALA   69 - CA    ALA   69  -2.84  20   1.95   2.04  +++++++++++++*++++++&lt;br /&gt;
    Ori 1 H     ALA   69 - N     ALA   69  -3.32  20   2.01   2.33  ++++++++++++++++*+++&lt;br /&gt;
    Ori 1 N     THR   70 - C     ALA   69   0.25  16   0.31   1.06  ++++++++*+++ + +  ++&lt;br /&gt;
    Ori 1 H     ASN   79 - N     ASN   79  -4.71  10   0.17   0.32  + *+ +  ++++   +  +&lt;br /&gt;
    Ori 1 H     GLY   92 - N     GLY   92  -5.54   8   0.15   0.51     ++++*       +  ++&lt;br /&gt;
    Ori 1 H     LEU   94 - N     LEU   94   0.42   6   0.14   0.54   +*+     +++&lt;br /&gt;
    3 violated distance restraints.&lt;br /&gt;
    5 violated van der Waals restraints.&lt;br /&gt;
    6 violated residual dipolar coupling restraints.&lt;br /&gt;
 &lt;br /&gt;
 &lt;br /&gt;
    RDC statistics:&lt;br /&gt;
    Correlation coefficient      :    0.906 +/-  0.003    (0.899..0.909, best in conformer 4)&lt;br /&gt;
    Q = rms(Dcalc-Dobs)/rms(Dobs):   42.709 +/-  0.583 %  (42.073..44.194)&lt;br /&gt;
    Q normalized by tensor       :   32.943 +/-  0.638 %  (32.231..34.776)&lt;br /&gt;
    Alignment tensor magnitude   :    5.881 +/-  0.045 Hz (5.760..5.950, best 5.898; input 5.898)&lt;br /&gt;
    Alignment tensor rhombicity  :    0.537 +/-  0.007    (0.524..0.556, best 0.539; input 0.539)&lt;br /&gt;
 &lt;br /&gt;
 &lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 14 Dec 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_calculation_with_CYANA&amp;diff=3278</id>
		<title>Structure calculation with CYANA</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Structure_calculation_with_CYANA&amp;diff=3278"/>
		<updated>2009-12-14T20:54:40Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;#[[CYANA|Getting started]] &lt;br /&gt;
#[[FOUND|FOUND]] &lt;br /&gt;
#[[TALOS|TALOS]] &lt;br /&gt;
#[[GLOMSA|GLOMSA]] &lt;br /&gt;
#[[NOE Calibration Using CYANA|NOE calibration]] &lt;br /&gt;
#[[Manual Structure Calculation Using CYANA|Manual structure calculation]] &lt;br /&gt;
#[[Automated NOESY Assignment Using CYANA|Automated NOESY assignment and structure calculation]] &lt;br /&gt;
#[[Structure Calculation With RDC's Using CYANA|Structure calculation with residual dipolar couplings]] (Applies to cyana-3.0 only) (link to REDCAT/PALES,FINDTENSOR, .rdc file, adding ORI to PDB file) &lt;br /&gt;
#[[Homodimer Structure Calculation Using CYANA|Homodimer structure calculations]][[Homodimer Structure Calculation Using CYANA|&amp;lt;br&amp;gt;]]&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=3273</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=3273"/>
		<updated>2009-12-14T20:39:25Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite ([http://www.ncbi.nlm.nih.gov/pubmed/14872126 AVS]) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as consistency to IUPAC residue/atom naming, chemical shifts that are widely outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and is included as part of the Protein Structure Validation Suite (PSVS).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Practical Aspects'''  ==&lt;br /&gt;
&lt;br /&gt;
=== Running AVS ===&lt;br /&gt;
&lt;br /&gt;
A number of version for the standalone AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1). Two perl scripts can be run from any directory on any computer running perl by either pointing to the local AutoAssign script repository directory or by downloading the scripts linked below.&amp;amp;nbsp; Here an example script is provideded that generates the bmrb in 2.1 format directly from the sparky resonance list 'rl' and the protein sequences.&amp;amp;nbsp; The script validates and computes the completeness statistics for the generated chemical shift list.&amp;amp;nbsp; As modifications are made in the sparky project the operation is repeated until a final bmrb file is achieved.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/Local/AutoAssign1.14/bin/sparkyRL2bmrb.pl HsR50_bb.rl test_bmrb.bmrb 1 MSPIPLPVTDTDDAWRARIAA&lt;br /&gt;
HRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLF&lt;br /&gt;
VPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH -diasterio&lt;br /&gt;
/Local/AutoAssign1.14/bin/missing_shifts.pl -printstats test_bmrb.bmrb &amp;amp;gt; missing_HsR50_101109&lt;br /&gt;
/Local/AutoAssign1.14/bin/validate_assignments.pl test_bmrb.bmrb &amp;amp;gt; vali_HsR50_101109&lt;br /&gt;
cp test_bmrb.bmrb HsR50_bb.bmrb&lt;br /&gt;
rm test_bmrb.bmrb&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; Three scripts are run: 1) [[Media:SparkyRL2bmrb.txt|sparkyRL2bmrb.pl]], 2) [[Media:Missing_shifts.txt|missing_shifts.pl]], and 3) [[Media:Validate_assignments.txt|validate_assignments.pl]]. In addition, a bmrb parsing module [[Media:BMRBParsing.pm|BMRBParsing.pm]] is called that interprets the sequence in single letter code and returns numbering in the bmrb file, in this case starting from residue 1. &lt;br /&gt;
&lt;br /&gt;
Newer file versions are available in later versions of the AutoAssign program that should handle bmrb 3.1 format. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== '''Output interpretation'''  ===&lt;br /&gt;
&lt;br /&gt;
The output interpretation is straightforward. A view of the output for res. 189-191 from the validation script is shown below, the summary of errors at the bottom of the file provides quick list of overall problems to the scientist:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;D189    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    D 0.28   L 0.17   N 0.12   C 0.11   K 0.09   F 0.09   Y 0.08   R 0.01  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     D13 R126&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 176.670     CA&amp;amp;nbsp;:: 54.404     CB&amp;amp;nbsp;:: 40.809&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.458     HA&amp;amp;nbsp;:: 4.591&lt;br /&gt;
&lt;br /&gt;
L190    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    L 0.22   K 0.2   D 0.14   R 0.12   C 0.1   F 0.09   Y 0.07   N 0.02  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     A20&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 177.898     CA&amp;amp;nbsp;:: 55.723     CB&amp;amp;nbsp;:: 41.968&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.115     HA&amp;amp;nbsp;:: 4.191&lt;br /&gt;
&lt;br /&gt;
E191    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    E 0.14   H 0.13   W 0.13   R 0.13   Q 0.13   C 0.11   K 0.1   M 0.05   I 0.02   V 0.01  &lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 176.524     CA&amp;amp;nbsp;:: 57.003     CB&amp;amp;nbsp;:: 29.910&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.226     HA&amp;amp;nbsp;:: 4.107&lt;br /&gt;
&lt;br /&gt;
Error Summary:&lt;br /&gt;
G92    HA2 = 5.318(S),     Expected =  3.95, Std = 0.4000, ChiSquare = 6.2621e-04&lt;br /&gt;
P116    HA = 5.681(S),     Expected =  4.41, Std = 0.3600, ChiSquare = 4.1469e-04&lt;br /&gt;
R132    Typing: Mistyped&lt;br /&gt;
R132    CB = 38.217(S),     Expected = 30.66, Std = 1.7700, ChiSquare = 1.9592e-05&lt;br /&gt;
A160    HB = 0.090(S),     Expected =  1.38, Std = 0.2500, ChiSquare = 2.4695e-07&lt;br /&gt;
T181    HA = 2.217(S),     Expected =  4.48, Std = 0.5000, ChiSquare = 6.0111e-06&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
Several issues are flagged in the error summary for this entry, proton frequency out of range and CB&amp;amp;nbsp;for R132 out of range to indicate possible mis-assignment. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Below is a view of the missing_shift.pl script.&amp;amp;nbsp; For the protein in the example, backbone assignment only was conducted (unlisted atoms are present in the bmrb): &lt;br /&gt;
&amp;lt;pre&amp;gt;D189:    HB2  HB3 &lt;br /&gt;
L190:    CD1  CD2  CG  HB2  HB3  HD1  HD2  HG &lt;br /&gt;
E191:    CG  HB2  HB3  HG2  HG3 &lt;br /&gt;
&lt;br /&gt;
AtomType Completeness Statistics:&lt;br /&gt;
                aromatic completeness&amp;amp;nbsp;::    0 /  174 =   0.00%&lt;br /&gt;
                backbone completeness&amp;amp;nbsp;::  845 /  965 =  87.56%&lt;br /&gt;
                sidechain completeness&amp;amp;nbsp;::  227 / 1244 =  18.25%&lt;br /&gt;
                unambiguous CH2 completeness&amp;amp;nbsp;::    0 /   20 =   0.00%&lt;br /&gt;
                unambiguous CH3 completeness&amp;amp;nbsp;::    0 /   32 =   0.00%&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
       C&amp;amp;nbsp;::  168 /  197 =  85.28%&lt;br /&gt;
      CA&amp;amp;nbsp;::  181 /  197 =  91.88%&lt;br /&gt;
      CB&amp;amp;nbsp;::  167 /  183 =  91.26%&lt;br /&gt;
       H&amp;amp;nbsp;::  160 /  180 =  88.89%&lt;br /&gt;
      HA&amp;amp;nbsp;::  156 /  183 =  85.25%&lt;br /&gt;
     HA2&amp;amp;nbsp;::   11 /   14 =  78.57%&lt;br /&gt;
     HA3&amp;amp;nbsp;::    9 /   14 =  64.29%&lt;br /&gt;
      HB&amp;amp;nbsp;::    8 /   56 =  14.29%&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2131</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2131"/>
		<updated>2009-11-23T21:38:05Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= '''Introduction'''  =&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite ([http://www.ncbi.nlm.nih.gov/pubmed/14872126 AVS]) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as consistency to IUPAC residue/atom naming, chemical shifts that are widely outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and is included as part of the Protein Structure Validation Suite (PSVS).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=== Practical Aspects  ===&lt;br /&gt;
&lt;br /&gt;
A number of version for the standalone AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1). Two perl scripts can be run from any directory on any computer running perl by either pointing to the local AutoAssign script repository directory or by downloading the scripts linked below.&amp;amp;nbsp; Here an example script is provideded that generates the bmrb in 2.1 format directly from the sparky resonance list 'rl' and the protein sequences.&amp;amp;nbsp; The script validates and computes the completeness statistics for the generated chemical shift list.&amp;amp;nbsp; As modifications are made in the sparky project the operation is repeated until a final bmrb file is achieved.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/Local/AutoAssign1.14/bin/sparkyRL2bmrb.pl HsR50_bb.rl test_bmrb.bmrb 1 MSPIPLPVTDTDDAWRARIAA&lt;br /&gt;
HRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLF&lt;br /&gt;
VPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH -diasterio&lt;br /&gt;
/Local/AutoAssign1.14/bin/missing_shifts.pl -printstats test_bmrb.bmrb &amp;amp;gt; missing_HsR50_101109&lt;br /&gt;
/Local/AutoAssign1.14/bin/validate_assignments.pl test_bmrb.bmrb &amp;amp;gt; vali_HsR50_101109&lt;br /&gt;
cp test_bmrb.bmrb HsR50_bb.bmrb&lt;br /&gt;
rm test_bmrb.bmrb&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; Three scripts are run: 1) [[Media:SparkyRL2bmrb.txt|sparkyRL2bmrb.pl]], 2) [[Media:Missing_shifts.txt|missing_shifts.pl]], and 3) [[Media:Validate_assignments.txt|validate_assignments.pl]]. In addition, a bmrb parsing module [[Media:BMRBParsing.pm|BMRBParsing.pm]] is called that interprets the sequence in single letter code and returns numbering in the bmrb file, in this case starting from residue 1. &lt;br /&gt;
&lt;br /&gt;
Newer file versions are available in later versions of the AutoAssign program that should handle bmrb 3.1 format. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Output interpretation  ===&lt;br /&gt;
&lt;br /&gt;
The output interpretation is straightforward. A view of the output for res. 189-191 from the validation script is shown below, the summary of errors at the bottom of the file provides quick list of overall problems to the scientist:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;D189    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    D 0.28   L 0.17   N 0.12   C 0.11   K 0.09   F 0.09   Y 0.08   R 0.01  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     D13 R126&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 176.670     CA&amp;amp;nbsp;:: 54.404     CB&amp;amp;nbsp;:: 40.809&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.458     HA&amp;amp;nbsp;:: 4.591&lt;br /&gt;
&lt;br /&gt;
L190    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    L 0.22   K 0.2   D 0.14   R 0.12   C 0.1   F 0.09   Y 0.07   N 0.02  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     A20&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 177.898     CA&amp;amp;nbsp;:: 55.723     CB&amp;amp;nbsp;:: 41.968&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.115     HA&amp;amp;nbsp;:: 4.191&lt;br /&gt;
&lt;br /&gt;
E191    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    E 0.14   H 0.13   W 0.13   R 0.13   Q 0.13   C 0.11   K 0.1   M 0.05   I 0.02   V 0.01  &lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 176.524     CA&amp;amp;nbsp;:: 57.003     CB&amp;amp;nbsp;:: 29.910&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.226     HA&amp;amp;nbsp;:: 4.107&lt;br /&gt;
&lt;br /&gt;
Error Summary:&lt;br /&gt;
G92    HA2 = 5.318(S),     Expected =  3.95, Std = 0.4000, ChiSquare = 6.2621e-04&lt;br /&gt;
P116    HA = 5.681(S),     Expected =  4.41, Std = 0.3600, ChiSquare = 4.1469e-04&lt;br /&gt;
R132    Typing: Mistyped&lt;br /&gt;
R132    CB = 38.217(S),     Expected = 30.66, Std = 1.7700, ChiSquare = 1.9592e-05&lt;br /&gt;
A160    HB = 0.090(S),     Expected =  1.38, Std = 0.2500, ChiSquare = 2.4695e-07&lt;br /&gt;
T181    HA = 2.217(S),     Expected =  4.48, Std = 0.5000, ChiSquare = 6.0111e-06&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
Several issues are flagged in the error summary for this entry, proton frequency out of range and CB&amp;amp;nbsp;for R132 out of range to indicate possible mis-assignment. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Below is a view of the missing_shift.pl script.&amp;amp;nbsp; For the protein in the example backbone assignment only was conducted (unlisted atoms are present in the bmrb): &lt;br /&gt;
&amp;lt;pre&amp;gt;D189:    HB2  HB3 &lt;br /&gt;
L190:    CD1  CD2  CG  HB2  HB3  HD1  HD2  HG &lt;br /&gt;
E191:    CG  HB2  HB3  HG2  HG3 &lt;br /&gt;
&lt;br /&gt;
AtomType Completeness Statistics:&lt;br /&gt;
                aromatic completeness&amp;amp;nbsp;::    0 /  174 =   0.00%&lt;br /&gt;
                backbone completeness&amp;amp;nbsp;::  845 /  965 =  87.56%&lt;br /&gt;
                sidechain completeness&amp;amp;nbsp;::  227 / 1244 =  18.25%&lt;br /&gt;
                unambiguous CH2 completeness&amp;amp;nbsp;::    0 /   20 =   0.00%&lt;br /&gt;
                unambiguous CH3 completeness&amp;amp;nbsp;::    0 /   32 =   0.00%&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
       C&amp;amp;nbsp;::  168 /  197 =  85.28%&lt;br /&gt;
      CA&amp;amp;nbsp;::  181 /  197 =  91.88%&lt;br /&gt;
      CB&amp;amp;nbsp;::  167 /  183 =  91.26%&lt;br /&gt;
       H&amp;amp;nbsp;::  160 /  180 =  88.89%&lt;br /&gt;
      HA&amp;amp;nbsp;::  156 /  183 =  85.25%&lt;br /&gt;
     HA2&amp;amp;nbsp;::   11 /   14 =  78.57%&lt;br /&gt;
     HA3&amp;amp;nbsp;::    9 /   14 =  64.29%&lt;br /&gt;
      HB&amp;amp;nbsp;::    8 /   56 =  14.29%&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2130</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2130"/>
		<updated>2009-11-23T21:35:03Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Media:Iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; The LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [''U''-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [''U''-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the different number of bound deuterons which affect the value of the carbon to different degree. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Running LACS'''  ==&lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using an edited version of the chemical shift file in bmrb 2.1 format, the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are: &lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
A running [[Media:WR73-ILVFY_111809_4LACS.bmrb|bmrb]] file and text [[Media:LACS_output.txt|output]] example are provided for user's convenience, adhering to the format should provide smooth operation of the server.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example BMRB&amp;amp;nbsp;input for LACS  ===&lt;br /&gt;
&amp;lt;pre&amp;gt; _Mol_residue_sequence&lt;br /&gt;
;&lt;br /&gt;
MLIYKDIFTDDELSSDSFPM&lt;br /&gt;
KLVDDLVYEFKGKHVVRKEG&lt;br /&gt;
EIVLAGSNPSAEEGAEDDGS&lt;br /&gt;
DEHVERGIDIVLNHKLVEMN&lt;br /&gt;
CYEDASMFKAYIKKFMKNVI&lt;br /&gt;
DHMEKNNRDKADVDAFKKKI&lt;br /&gt;
QGWVVSLLAKDRFKNLAFFI&lt;br /&gt;
GERAAEGAENGQVAIIEYRD&lt;br /&gt;
VDGTEVPTLMLVKEAIIEEK&lt;br /&gt;
CLE&lt;br /&gt;
;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
  loop_&lt;br /&gt;
    _Residue_seq_code&lt;br /&gt;
    _Residue_label&lt;br /&gt;
    _Chem_shift_ambiguity_code&lt;br /&gt;
4    1     MET     C     C    170.742     .     1&lt;br /&gt;
5    1     MET     CA     C    54.828     .     1&lt;br /&gt;
6    1     MET     CB     C    32.579     .     1&lt;br /&gt;
7    2     LEU     H     H    8.934     .     1&lt;br /&gt;
8    2     LEU     HD1     H    0.688     .     1&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example LACS ouput  ===&lt;br /&gt;
&lt;br /&gt;
The CA correction of -0.19 ppm is found (last line). &lt;br /&gt;
&amp;lt;pre&amp;gt;data_LACS&lt;br /&gt;
&lt;br /&gt;
         #################################&lt;br /&gt;
         #    LACS Output Information    #&lt;br /&gt;
         #################################&lt;br /&gt;
&lt;br /&gt;
############################################################&lt;br /&gt;
#              LACS Designator Definition                  #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#   Index Value                    Definition              #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#        0                          Outliers               #&lt;br /&gt;
#        1                        Normal points            #&lt;br /&gt;
#                                                          # &lt;br /&gt;
############################################################            &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
save_LACS_CACB_CA_output&lt;br /&gt;
 _LACS_plot.Sf_category                   LACS_output&lt;br /&gt;
 _LACS_plot.Input_file_name               &amp;quot;data.txt&amp;quot;&lt;br /&gt;
&lt;br /&gt;
 _LACS_plot.X_coord_name                  CA-CB&lt;br /&gt;
 _LACS_plot.Y_coord_name                  CA&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_1     -6.35&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_1     -2.37&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_2      1.99&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_2      0.93&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_1     -2.00&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_1     -1.18&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_2      5.76&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_2      4.33&lt;br /&gt;
 _LACS_plot.Y_axis_chem_shift_offset      -0.19&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Practical Experience with Running LACS in the NESG'''  ==&lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triply labeled proteins we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triply labeled samples. &amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2129</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2129"/>
		<updated>2009-11-23T21:32:41Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= '''Introduction'''  =&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite ([http://www.ncbi.nlm.nih.gov/pubmed/14872126 AVS]) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as consistency to IUPAC residue/atom naming, chemical shifts that are widely outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and is included as part of the Protein Structure Validation Suite (PSVS).&amp;amp;nbsp; It is wise to run any chemical shift validation prior to structure determination, and uncover problems with the assignments that could impact the performance of noesy assignments and structure calculation downstream.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Practical Aspects  ===&lt;br /&gt;
&lt;br /&gt;
A number of version for the standalone AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1). Two perl scripts can be run from any directory on any computer running perl by either pointing to the local AutoAssign script repository directory or by downloading the scripts linked below.&amp;amp;nbsp; Here an example script is provideded that generates the bmrb in 2.1 format directly from the sparky resonance list 'rl' and the protein sequences.&amp;amp;nbsp; The script validates and computes the completeness statistics for the generated chemical shift list.&amp;amp;nbsp; As modifications are made in the sparky project the operation is repeated until a final bmrb file is achieved.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/Local/AutoAssign1.14/bin/sparkyRL2bmrb.pl HsR50_bb.rl test_bmrb.bmrb 1 MSPIPLPVTDTDDAWRARIAA&lt;br /&gt;
HRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLF&lt;br /&gt;
VPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH -diasterio&lt;br /&gt;
/Local/AutoAssign1.14/bin/missing_shifts.pl -printstats test_bmrb.bmrb &amp;amp;gt; missing_HsR50_101109&lt;br /&gt;
/Local/AutoAssign1.14/bin/validate_assignments.pl test_bmrb.bmrb &amp;amp;gt; vali_HsR50_101109&lt;br /&gt;
cp test_bmrb.bmrb HsR50_bb.bmrb&lt;br /&gt;
rm test_bmrb.bmrb&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; Three scripts are run: 1) [[Media:SparkyRL2bmrb.txt|sparkyRL2bmrb.pl]], 2) [[Media:Missing_shifts.txt|missing_shifts.pl]], and 3) [[Media:Validate_assignments.txt|validate_assignments.pl]]. In addition, a bmrb parsing module [[Media:BMRBParsing.pm|BMRBParsing.pm]] is called that interprets the sequence in single letter code and returns numbering in the bmrb file, in this case starting from residue 1. &lt;br /&gt;
&lt;br /&gt;
Newer file versions are available in later versions of the AutoAssign program that should handle bmrb 3.1 format. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Output interpretation  ===&lt;br /&gt;
&lt;br /&gt;
The output interpretation is straightforward. A view of the output for res. 189-191 from the validation script is shown below, the summary of errors at the bottom of the file provides quick list of overall problems to the scientist:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;D189    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    D 0.28   L 0.17   N 0.12   C 0.11   K 0.09   F 0.09   Y 0.08   R 0.01  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     D13 R126&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 176.670     CA&amp;amp;nbsp;:: 54.404     CB&amp;amp;nbsp;:: 40.809&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.458     HA&amp;amp;nbsp;:: 4.591&lt;br /&gt;
&lt;br /&gt;
L190    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    L 0.22   K 0.2   D 0.14   R 0.12   C 0.1   F 0.09   Y 0.07   N 0.02  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     A20&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 177.898     CA&amp;amp;nbsp;:: 55.723     CB&amp;amp;nbsp;:: 41.968&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.115     HA&amp;amp;nbsp;:: 4.191&lt;br /&gt;
&lt;br /&gt;
E191    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    E 0.14   H 0.13   W 0.13   R 0.13   Q 0.13   C 0.11   K 0.1   M 0.05   I 0.02   V 0.01  &lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 176.524     CA&amp;amp;nbsp;:: 57.003     CB&amp;amp;nbsp;:: 29.910&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.226     HA&amp;amp;nbsp;:: 4.107&lt;br /&gt;
&lt;br /&gt;
Error Summary:&lt;br /&gt;
G92    HA2 = 5.318(S),     Expected =  3.95, Std = 0.4000, ChiSquare = 6.2621e-04&lt;br /&gt;
P116    HA = 5.681(S),     Expected =  4.41, Std = 0.3600, ChiSquare = 4.1469e-04&lt;br /&gt;
R132    Typing: Mistyped&lt;br /&gt;
R132    CB = 38.217(S),     Expected = 30.66, Std = 1.7700, ChiSquare = 1.9592e-05&lt;br /&gt;
A160    HB = 0.090(S),     Expected =  1.38, Std = 0.2500, ChiSquare = 2.4695e-07&lt;br /&gt;
T181    HA = 2.217(S),     Expected =  4.48, Std = 0.5000, ChiSquare = 6.0111e-06&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
Several issues are flagged in the error summary for this entry, proton frequency out of range and CB&amp;amp;nbsp;for R132 out of range to indicate possible mis-assignment.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Below is a view of the missing_shift.pl script.&amp;amp;nbsp; For the protein in the example backbone assignment only was conducted (unlisted atoms are present in the bmrb): &lt;br /&gt;
&amp;lt;pre&amp;gt;D189:    HB2  HB3 &lt;br /&gt;
L190:    CD1  CD2  CG  HB2  HB3  HD1  HD2  HG &lt;br /&gt;
E191:    CG  HB2  HB3  HG2  HG3 &lt;br /&gt;
&lt;br /&gt;
AtomType Completeness Statistics:&lt;br /&gt;
                aromatic completeness&amp;amp;nbsp;::    0 /  174 =   0.00%&lt;br /&gt;
                backbone completeness&amp;amp;nbsp;::  845 /  965 =  87.56%&lt;br /&gt;
                sidechain completeness&amp;amp;nbsp;::  227 / 1244 =  18.25%&lt;br /&gt;
                unambiguous CH2 completeness&amp;amp;nbsp;::    0 /   20 =   0.00%&lt;br /&gt;
                unambiguous CH3 completeness&amp;amp;nbsp;::    0 /   32 =   0.00%&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
       C&amp;amp;nbsp;::  168 /  197 =  85.28%&lt;br /&gt;
      CA&amp;amp;nbsp;::  181 /  197 =  91.88%&lt;br /&gt;
      CB&amp;amp;nbsp;::  167 /  183 =  91.26%&lt;br /&gt;
       H&amp;amp;nbsp;::  160 /  180 =  88.89%&lt;br /&gt;
      HA&amp;amp;nbsp;::  156 /  183 =  85.25%&lt;br /&gt;
     HA2&amp;amp;nbsp;::   11 /   14 =  78.57%&lt;br /&gt;
     HA3&amp;amp;nbsp;::    9 /   14 =  64.29%&lt;br /&gt;
      HB&amp;amp;nbsp;::    8 /   56 =  14.29%&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2128</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2128"/>
		<updated>2009-11-23T21:26:41Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= '''Introduction'''  =&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite ([http://www.ncbi.nlm.nih.gov/pubmed/14872126 AVS]) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as consistency to IUPAC residue/atom naming, chemical shifts that are widely outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and is included as part of the Protein Structure Validation Suite (PSVS).&amp;amp;nbsp; It is wise to run any chemical shift validation prior to structure determination, and uncover problems with the assignments that could impact the performance of noesy assignments and structure calculation downstream.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Practical Aspects  ===&lt;br /&gt;
&lt;br /&gt;
A number of version for the standalone AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1). Two perl scripts can be run from any directory on any computer running perl by either pointing to the local AutoAssign script repository directory or by downloading the scripts linked below.&amp;amp;nbsp; Here an example script is provideded that generates the bmrb in 2.1 format directly from the sparky resonance list 'rl' and the protein sequences.&amp;amp;nbsp; The script validates and computes the completeness statistics for the generated chemical shift list.&amp;amp;nbsp; As modifications are made in the sparky project the operation is repeated until a final bmrb file is achieved.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/Local/AutoAssign1.14/bin/sparkyRL2bmrb.pl HsR50_bb.rl test_bmrb.bmrb 1 MSPIPLPVTDTDDAWRARIAA&lt;br /&gt;
HRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLF&lt;br /&gt;
VPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH -diasterio&lt;br /&gt;
/Local/AutoAssign1.14/bin/missing_shifts.pl -printstats test_bmrb.bmrb &amp;amp;gt; missing_HsR50_101109&lt;br /&gt;
/Local/AutoAssign1.14/bin/validate_assignments.pl test_bmrb.bmrb &amp;amp;gt; vali_HsR50_101109&lt;br /&gt;
cp test_bmrb.bmrb HsR50_bb.bmrb&lt;br /&gt;
rm test_bmrb.bmrb&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; Three scripts are run: 1) [[Media:SparkyRL2bmrb.txt|sparkyRL2bmrb.pl]], 2) [[Media:Missing_shifts.txt|missing_shifts.pl]], and 3) [[Media:Validate_assignments.txt|validate_assignments.pl]]. In addition, a bmrb parsing module [[Media:BMRBParsing.pm|BMRBParsing.pm]] is called that interprets the sequence in single letter code and returns numbering in the bmrb file, in this case starting from residue 1. &lt;br /&gt;
&lt;br /&gt;
Newer file versions are available in later versions of the AutoAssign program that should handle bmrb 3.1 format. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Output interpretation  ===&lt;br /&gt;
&lt;br /&gt;
The output interpretation is straightforward. A view of the output for res. 189-191 from the validation script is shown below, the summary of errors at the bottom of the file provides quick list of overall problems to the scientist:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;&lt;br /&gt;
D189    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    D 0.28   L 0.17   N 0.12   C 0.11   K 0.09   F 0.09   Y 0.08   R 0.01  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     D13 R126&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 176.670     CA&amp;amp;nbsp;:: 54.404     CB&amp;amp;nbsp;:: 40.809&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.458     HA&amp;amp;nbsp;:: 4.591&lt;br /&gt;
&lt;br /&gt;
L190    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    L 0.22   K 0.2   D 0.14   R 0.12   C 0.1   F 0.09   Y 0.07   N 0.02  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     A20&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 177.898     CA&amp;amp;nbsp;:: 55.723     CB&amp;amp;nbsp;:: 41.968&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.115     HA&amp;amp;nbsp;:: 4.191&lt;br /&gt;
&lt;br /&gt;
E191    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    E 0.14   H 0.13   W 0.13   R 0.13   Q 0.13   C 0.11   K 0.1   M 0.05   I 0.02   V 0.01  &lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C&amp;amp;nbsp;:: 176.524     CA&amp;amp;nbsp;:: 57.003     CB&amp;amp;nbsp;:: 29.910&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H&amp;amp;nbsp;:: 8.226     HA&amp;amp;nbsp;:: 4.107&lt;br /&gt;
&lt;br /&gt;
Error Summary:&lt;br /&gt;
G92    HA2 = 5.318(S),     Expected =  3.95, Std = 0.4000, ChiSquare = 6.2621e-04&lt;br /&gt;
P116    HA = 5.681(S),     Expected =  4.41, Std = 0.3600, ChiSquare = 4.1469e-04&lt;br /&gt;
R132    Typing: Mistyped&lt;br /&gt;
R132    CB = 38.217(S),     Expected = 30.66, Std = 1.7700, ChiSquare = 1.9592e-05&lt;br /&gt;
A160    HB = 0.090(S),     Expected =  1.38, Std = 0.2500, ChiSquare = 2.4695e-07&lt;br /&gt;
T181    HA = 2.217(S),     Expected =  4.48, Std = 0.5000, ChiSquare = 6.0111e-06&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
Here is a view of the missing_shift.pl script.&amp;amp;nbsp; For the protein in the example backbone assignment only was conducted: &lt;br /&gt;
&amp;lt;pre&amp;gt;D189:    HB2  HB3 &lt;br /&gt;
L190:    CD1  CD2  CG  HB2  HB3  HD1  HD2  HG &lt;br /&gt;
E191:    CG  HB2  HB3  HG2  HG3 &lt;br /&gt;
&lt;br /&gt;
AtomType Completeness Statistics:&lt;br /&gt;
                aromatic completeness&amp;amp;nbsp;::    0 /  174 =   0.00%&lt;br /&gt;
                backbone completeness&amp;amp;nbsp;::  845 /  965 =  87.56%&lt;br /&gt;
                sidechain completeness&amp;amp;nbsp;::  227 / 1244 =  18.25%&lt;br /&gt;
                unambiguous CH2 completeness&amp;amp;nbsp;::    0 /   20 =   0.00%&lt;br /&gt;
                unambiguous CH3 completeness&amp;amp;nbsp;::    0 /   32 =   0.00%&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
       C&amp;amp;nbsp;::  168 /  197 =  85.28%&lt;br /&gt;
      CA&amp;amp;nbsp;::  181 /  197 =  91.88%&lt;br /&gt;
      CB&amp;amp;nbsp;::  167 /  183 =  91.26%&lt;br /&gt;
       H&amp;amp;nbsp;::  160 /  180 =  88.89%&lt;br /&gt;
      HA&amp;amp;nbsp;::  156 /  183 =  85.25%&lt;br /&gt;
     HA2&amp;amp;nbsp;::   11 /   14 =  78.57%&lt;br /&gt;
     HA3&amp;amp;nbsp;::    9 /   14 =  64.29%&lt;br /&gt;
      HB&amp;amp;nbsp;::    8 /   56 =  14.29%&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2127</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2127"/>
		<updated>2009-11-23T21:22:32Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Media:Iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; The LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [''U''-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [''U''-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the different number of bound deuterons which affect the value of the carbon to different degree. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Running LACS'''  ==&lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using an edited version of the chemical shift file in bmrb 2.1 format, the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are: &lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
A running [[Media:WR73-ILVFY_111809_4LACS.bmrb|bmrb]] file and text [[Media:LACS_output.txt|output]] example are provided for user's convenience, adhering to the format should provide smooth operation of the server.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example BMRB&amp;amp;nbsp;input for LACS  ===&lt;br /&gt;
&amp;lt;pre&amp;gt; _Mol_residue_sequence&lt;br /&gt;
;&lt;br /&gt;
MLIYKDIFTDDELSSDSFPM&lt;br /&gt;
KLVDDLVYEFKGKHVVRKEG&lt;br /&gt;
EIVLAGSNPSAEEGAEDDGS&lt;br /&gt;
DEHVERGIDIVLNHKLVEMN&lt;br /&gt;
CYEDASMFKAYIKKFMKNVI&lt;br /&gt;
DHMEKNNRDKADVDAFKKKI&lt;br /&gt;
QGWVVSLLAKDRFKNLAFFI&lt;br /&gt;
GERAAEGAENGQVAIIEYRD&lt;br /&gt;
VDGTEVPTLMLVKEAIIEEK&lt;br /&gt;
CLE&lt;br /&gt;
;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
  loop_&lt;br /&gt;
    _Residue_seq_code&lt;br /&gt;
    _Residue_label&lt;br /&gt;
    _Chem_shift_ambiguity_code&lt;br /&gt;
4    1     MET     C     C    170.742     .     1&lt;br /&gt;
5    1     MET     CA     C    54.828     .     1&lt;br /&gt;
6    1     MET     CB     C    32.579     .     1&lt;br /&gt;
7    2     LEU     H     H    8.934     .     1&lt;br /&gt;
8    2     LEU     HD1     H    0.688     .     1&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example LACS ouput  ===&lt;br /&gt;
&lt;br /&gt;
The CA correction of -0.19 ppm is found (last line). &lt;br /&gt;
&amp;lt;pre&amp;gt;data_LACS&lt;br /&gt;
&lt;br /&gt;
         #################################&lt;br /&gt;
         #    LACS Output Information    #&lt;br /&gt;
         #################################&lt;br /&gt;
&lt;br /&gt;
############################################################&lt;br /&gt;
#              LACS Designator Definition                  #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#   Index Value                    Definition              #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#        0                          Outliers               #&lt;br /&gt;
#        1                        Normal points            #&lt;br /&gt;
#                                                          # &lt;br /&gt;
############################################################            &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
save_LACS_CACB_CA_output&lt;br /&gt;
 _LACS_plot.Sf_category                   LACS_output&lt;br /&gt;
 _LACS_plot.Input_file_name               &amp;quot;data.txt&amp;quot;&lt;br /&gt;
&lt;br /&gt;
 _LACS_plot.X_coord_name                  CA-CB&lt;br /&gt;
 _LACS_plot.Y_coord_name                  CA&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_1     -6.35&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_1     -2.37&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_2      1.99&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_2      0.93&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_1     -2.00&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_1     -1.18&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_2      5.76&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_2      4.33&lt;br /&gt;
 _LACS_plot.Y_axis_chem_shift_offset      -0.19&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Practical Experience with Running LACS in the NESG'''  ==&lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triply labeled proteins we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triply labeled samples. &amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2126</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2126"/>
		<updated>2009-11-23T21:21:29Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= '''Introduction'''  =&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite ([http://www.ncbi.nlm.nih.gov/pubmed/14872126 AVS]) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as consistency to IUPAC&amp;amp;nbsp;labeling, chemical shifts that are grossly outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and can be included as part of the Protein Structure Validation Suite (PSVS) run.&amp;amp;nbsp; It is advisable to run any chemical shift validation prior to structure determination steps in order to uncover problems with the assignments that could impact the performance of noesy assignments and structure calculation downstream.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Practical Aspects  ===&lt;br /&gt;
&lt;br /&gt;
A number of version for the standalone AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1). Two perl scripts can be run from any directory on any computer running perl by either pointing to the local AutoAssign script repository directory or by downloading the scripts linked below.&amp;amp;nbsp; Here an example script is provideded that generates the bmrb in 2.1 format directly from the sparky resonance list 'rl' and the protein sequences.&amp;amp;nbsp; The script validates and computes the completeness statistics for the generated chemical shift list.&amp;amp;nbsp; As modifications are made in the sparky project the operation is repeated until a final bmrb file is achieved.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/Local/AutoAssign1.14/bin/sparkyRL2bmrb.pl HsR50_bb.rl test_bmrb.bmrb 1 MSPIPLPVTDTDDAWRARIAA&lt;br /&gt;
HRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLF&lt;br /&gt;
VPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH -diasterio&lt;br /&gt;
/Local/AutoAssign1.14/bin/missing_shifts.pl -printstats test_bmrb.bmrb &amp;amp;gt; missing_HsR50_101109&lt;br /&gt;
/Local/AutoAssign1.14/bin/validate_assignments.pl test_bmrb.bmrb &amp;amp;gt; vali_HsR50_101109&lt;br /&gt;
cp test_bmrb.bmrb HsR50_bb.bmrb&lt;br /&gt;
rm test_bmrb.bmrb&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; Three scripts are run: 1) [[Media:SparkyRL2bmrb.txt|sparkyRL2bmrb.pl]], 2) [[Media:Missing_shifts.txt|missing_shifts.pl]], and 3) [[Media:Validate_assignments.txt|validate_assignments.pl]]. In addition, a bmrb parsing module [[Media:BMRBParsing.pm|BMRBParsing.pm]] is called that interprets the sequence in single letter code and returns numbering in the bmrb file, in this case starting from residue 1. &lt;br /&gt;
&lt;br /&gt;
Newer file versions are available in later versions of the AutoAssign program that should handle bmrb 3.1 format. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=== Output interpretation ===&lt;br /&gt;
&lt;br /&gt;
The output interpretation is straightforward. A view of the output for res. 189-191 from the validation script is shown below, the summary of errors at the bottom of the file provides quick list of overall problems to the scientist:&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;&lt;br /&gt;
&lt;br /&gt;
D189    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    D 0.28   L 0.17   N 0.12   C 0.11   K 0.09   F 0.09   Y 0.08   R 0.01  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     D13 R126&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C :: 176.670     CA :: 54.404     CB :: 40.809&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H :: 8.458     HA :: 4.591&lt;br /&gt;
&lt;br /&gt;
L190    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    L 0.22   K 0.2   D 0.14   R 0.12   C 0.1   F 0.09   Y 0.07   N 0.02  &lt;br /&gt;
    HN Overlap&amp;amp;gt;&amp;amp;gt;     A20&lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C :: 177.898     CA :: 55.723     CB :: 41.968&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H :: 8.115     HA :: 4.191&lt;br /&gt;
&lt;br /&gt;
E191    Overall: Consistent     Typing: Consistent     SRO: Consistent     C Shifts: Consistent     H Shifts: Consistent&lt;br /&gt;
    PRTL&amp;amp;gt;&amp;amp;gt;    E 0.14   H 0.13   W 0.13   R 0.13   Q 0.13   C 0.11   K 0.1   M 0.05   I 0.02   V 0.01  &lt;br /&gt;
    C Shift Assignments&amp;amp;gt;&amp;amp;gt;     C :: 176.524     CA :: 57.003     CB :: 29.910&lt;br /&gt;
    H Shift Assignments&amp;amp;gt;&amp;amp;gt;     H :: 8.226     HA :: 4.107&lt;br /&gt;
&lt;br /&gt;
Error Summary:&lt;br /&gt;
G92    HA2 = 5.318(S),     Expected =  3.95, Std = 0.4000, ChiSquare = 6.2621e-04&lt;br /&gt;
P116    HA = 5.681(S),     Expected =  4.41, Std = 0.3600, ChiSquare = 4.1469e-04&lt;br /&gt;
R132    Typing: Mistyped&lt;br /&gt;
R132    CB = 38.217(S),     Expected = 30.66, Std = 1.7700, ChiSquare = 1.9592e-05&lt;br /&gt;
A160    HB = 0.090(S),     Expected =  1.38, Std = 0.2500, ChiSquare = 2.4695e-07&lt;br /&gt;
T181    HA = 2.217(S),     Expected =  4.48, Std = 0.5000, ChiSquare = 6.0111e-06&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
Here is a view of the missing_shift.pl script, for the protein in the example backbone assignment only was conducted: &lt;br /&gt;
&amp;lt;pre&amp;gt;D189:    HB2  HB3 &lt;br /&gt;
L190:    CD1  CD2  CG  HB2  HB3  HD1  HD2  HG &lt;br /&gt;
E191:    CG  HB2  HB3  HG2  HG3 &lt;br /&gt;
&lt;br /&gt;
AtomType Completeness Statistics:&lt;br /&gt;
                aromatic completeness ::    0 /  174 =   0.00%&lt;br /&gt;
                backbone completeness ::  845 /  965 =  87.56%&lt;br /&gt;
                sidechain completeness ::  227 / 1244 =  18.25%&lt;br /&gt;
                unambiguous CH2 completeness ::    0 /   20 =   0.00%&lt;br /&gt;
                unambiguous CH3 completeness ::    0 /   32 =   0.00%&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
       C ::  168 /  197 =  85.28%&lt;br /&gt;
      CA ::  181 /  197 =  91.88%&lt;br /&gt;
      CB ::  167 /  183 =  91.26%&lt;br /&gt;
       H ::  160 /  180 =  88.89%&lt;br /&gt;
      HA ::  156 /  183 =  85.25%&lt;br /&gt;
     HA2 ::   11 /   14 =  78.57%&lt;br /&gt;
     HA3 ::    9 /   14 =  64.29%&lt;br /&gt;
      HB ::    8 /   56 =  14.29%&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Editing in progress &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
PaoLo roSSi&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=File:SparkyRL2bmrb.txt&amp;diff=2125</id>
		<title>File:SparkyRL2bmrb.txt</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=File:SparkyRL2bmrb.txt&amp;diff=2125"/>
		<updated>2009-11-23T21:08:48Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2124</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2124"/>
		<updated>2009-11-23T21:02:57Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= '''Introduction'''  =&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite ([http://www.ncbi.nlm.nih.gov/pubmed/14872126 AVS]) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as consistency to IUPAC&amp;amp;nbsp;labeling, chemical shifts that are grossly outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and can be included as part of the Protein Structure Validation Suite (PSVS) run.&amp;amp;nbsp; It is advisable to run any chemical shift validation prior to structure determination steps in order to uncover problems with the assignments that could impact the performance of noesy assignments and structure calculation downstream.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Practical Aspects  ===&lt;br /&gt;
&lt;br /&gt;
A number of version for the standalone AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1). Two perl scripts can be run from any directory on any computer running perl by either pointing to the local AutoAssign script repository directory or by downloading the scripts linked below.&amp;amp;nbsp; Here an example script is provideded that generates the bmrb in 2.1 format directly from the sparky resonance list 'rl' and the protein sequences.&amp;amp;nbsp; The script validates and computes the completeness statistics for the generated chemical shift list.&amp;amp;nbsp; As modifications are made in the sparky project the operation is repeated until a final bmrb file is achieved.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/Local/AutoAssign1.14/bin/sparkyRL2bmrb.pl HsR50_bb.rl test_bmrb.bmrb 1 MSPIPLPVTDTDDAWRARIAA&lt;br /&gt;
HRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLF&lt;br /&gt;
VPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH -diasterio&lt;br /&gt;
/Local/AutoAssign1.14/bin/missing_shifts.pl -printstats test_bmrb.bmrb &amp;amp;gt; missing_HsR50_101109&lt;br /&gt;
/Local/AutoAssign1.14/bin/validate_assignments.pl test_bmrb.bmrb &amp;amp;gt; vali_HsR50_101109&lt;br /&gt;
cp test_bmrb.bmrb HsR50_bb.bmrb&lt;br /&gt;
rm test_bmrb.bmrb&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; Three scripts are run: 1) [[Media:SparkyRL2bmrb.txt|sparkyRL2bmrb.pl]], 2) [[Media:Missing_shifts.txt|missing_shifts.pl]], and 3) [[Media:Validate_assignments.txt|validate_assignments.pl]]. In addition, a bmrb parsing module [[Media:BMRBParsing.pm|BMRBParsing.pm]] is called that interprets the sequence in single letter code and numbers the bmrb residues, ind this case starting from 1. &lt;br /&gt;
&lt;br /&gt;
Newer file versions are available in later versions of the AutoAssign program that should handle bmrb 3.1 format. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Editing in progress &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
PaoLo roSSi&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2123</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2123"/>
		<updated>2009-11-23T21:02:17Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= '''Introduction'''  =&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite ([http://www.ncbi.nlm.nih.gov/pubmed/14872126 AVS]) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as consistency to IUPAC&amp;amp;nbsp;labeling, chemical shifts that are grossly outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and can be included as part of the Protein Structure Validation Suite (PSVS) run.&amp;amp;nbsp; It is advisable to run any chemical shift validation prior to structure determination steps in order to uncover problems with the assignments that could impact the performance of noesy assignments and structure calculation downstream.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Practical Aspects  ===&lt;br /&gt;
&lt;br /&gt;
A number of version for the standalone AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1). Two perl scripts can be run from any directory on any computer running perl by either pointing to the local AutoAssign script repository directory or by downloading the scripts linked below.&amp;amp;nbsp; Here an example script is provideded that generates the bmrb in 2.1 format directly from the sparky resonance list 'rl' and the protein sequences.&amp;amp;nbsp; The script validates and computes the completeness statistics for the generated chemical shift list.&amp;amp;nbsp; As modifications are made in the sparky project the operation is repeated until a final bmrb file is achieved.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/Local/AutoAssign1.14/bin/sparkyRL2bmrb.pl HsR50_bb.rl test_bmrb.bmrb 1 MSPIPLPVTDTDDAWRARIAA&lt;br /&gt;
HRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLF&lt;br /&gt;
VPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH -diasterio&lt;br /&gt;
/Local/AutoAssign1.14/bin/missing_shifts.pl -printstats test_bmrb.bmrb &amp;amp;gt; missing_HsR50_101109&lt;br /&gt;
/Local/AutoAssign1.14/bin/validate_assignments.pl test_bmrb.bmrb &amp;amp;gt; vali_HsR50_101109&lt;br /&gt;
cp test_bmrb.bmrb HsR50_bb.bmrb&lt;br /&gt;
rm test_bmrb.bmrb&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; Three scripts are run: 1) [[Media:SparkyRL2bmrb.txt|sparkyRL2bmrb.pl]], 2) [[Media:Missing_shifts.txt|missing_shifts.pl]], and 3) [[Media:validate_assignments.txt|validate_assignments.pl]]. In addition, a bmrb parsing module [[Media:BMRBparsing.pm|BMRBparsing.pm]] is called that interprets the sequence in single letter code and numbers the bmrb residues, ind this case starting from 1. &lt;br /&gt;
&lt;br /&gt;
Newer file versions are available in later versions of the AutoAssign program that should handle bmrb 3.1 format. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Editing in progress &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
PaoLo roSSi&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=File:Validate_assignments.txt&amp;diff=2122</id>
		<title>File:Validate assignments.txt</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=File:Validate_assignments.txt&amp;diff=2122"/>
		<updated>2009-11-23T21:01:19Z</updated>

		<summary type="html">&lt;p&gt;Prossi: uploaded a new version of &amp;quot;File:Validate assignments.txt&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2121</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2121"/>
		<updated>2009-11-23T21:00:14Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= '''Introduction'''  =&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite ([http://www.ncbi.nlm.nih.gov/pubmed/14872126 AVS]) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as consistency to IUPAC&amp;amp;nbsp;labeling, chemical shifts that are grossly outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and can be included as part of the Protein Structure Validation Suite (PSVS) run.&amp;amp;nbsp; It is advisable to run any chemical shift validation prior to structure determination steps in order to uncover problems with the assignments that could impact the performance of noesy assignments and structure calculation downstream.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Practical Aspects  ===&lt;br /&gt;
&lt;br /&gt;
A number of version for the standalone AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1). Two perl scripts can be run from any directory on any computer running perl by either pointing to the local AutoAssign script repository directory or by downloading the scripts linked below.&amp;amp;nbsp; Here an example script is provideded that generates the bmrb in 2.1 format directly from the sparky resonance list 'rl' and the protein sequences.&amp;amp;nbsp; The script validates and computes the completeness statistics for the generated chemical shift list.&amp;amp;nbsp; As modifications are made in the sparky project the operation is repeated until a final bmrb file is achieved.&amp;lt;br&amp;gt; &lt;br /&gt;
&amp;lt;pre&amp;gt;/Local/AutoAssign1.14/bin/sparkyRL2bmrb.pl HsR50_bb.rl test_bmrb.bmrb 1 MSPIPLPVTDTDDAWRARIAA&lt;br /&gt;
HRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLF&lt;br /&gt;
VPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH -diasterio&lt;br /&gt;
/Local/AutoAssign1.14/bin/missing_shifts.pl -printstats test_bmrb.bmrb &amp;amp;gt; missing_HsR50_101109&lt;br /&gt;
/Local/AutoAssign1.14/bin/validate_assignments.pl test_bmrb.bmrb &amp;amp;gt; vali_HsR50_101109&lt;br /&gt;
cp test_bmrb.bmrb HsR50_bb.bmrb&lt;br /&gt;
rm test_bmrb.bmrb&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; Three scripts are run: 1) [[Media:sparkyRL2bmrb.txt|sparkyRL2bmrb.pl]], 2) [[Media:missing_shifts.txt|missing_shifts.pl]], and 3) [[medis:validate_assignments.txt|validate_assignments.pl]]. In addition, a bmrb parsing module [[Media:BMRBparsing.pm|BMRBparsing.pm]] is called that interprets the sequence in single letter code and numbers the bmrb residues, ind this case starting from 1. &lt;br /&gt;
&lt;br /&gt;
Newer file versions are available in later versions of the AutoAssign program that should handle bmrb 3.1 format. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Editing in progress &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
PaoLo roSSi&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2120</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2120"/>
		<updated>2009-11-23T20:55:02Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Media:Iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; The LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [''U''-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [''U''-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the different number of bound deuterons which affect the value of the carbon to different degree. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Running LACS'''  ==&lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using an edited version of the chemical shift file in bmrb 2.1 format, the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are: &lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
A running [[Media:WR73-ILVFY_111809_4LACS.bmrb|bmrb]] file and text [[Media:LACS_output.txt|output]] example are provided for user's convenience, adhering to the format should provide smooth operation of the server.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example BMRB&amp;amp;nbsp;input for LACS  ===&lt;br /&gt;
&amp;lt;pre&amp;gt; _Mol_residue_sequence&lt;br /&gt;
;&lt;br /&gt;
MLIYKDIFTDDELSSDSFPM&lt;br /&gt;
KLVDDLVYEFKGKHVVRKEG&lt;br /&gt;
EIVLAGSNPSAEEGAEDDGS&lt;br /&gt;
DEHVERGIDIVLNHKLVEMN&lt;br /&gt;
CYEDASMFKAYIKKFMKNVI&lt;br /&gt;
DHMEKNNRDKADVDAFKKKI&lt;br /&gt;
QGWVVSLLAKDRFKNLAFFI&lt;br /&gt;
GERAAEGAENGQVAIIEYRD&lt;br /&gt;
VDGTEVPTLMLVKEAIIEEK&lt;br /&gt;
CLE&lt;br /&gt;
;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
  loop_&lt;br /&gt;
    _Residue_seq_code&lt;br /&gt;
    _Residue_label&lt;br /&gt;
    _Chem_shift_ambiguity_code&lt;br /&gt;
4    1     MET     C     C    170.742     .     1&lt;br /&gt;
5    1     MET     CA     C    54.828     .     1&lt;br /&gt;
6    1     MET     CB     C    32.579     .     1&lt;br /&gt;
7    2     LEU     H     H    8.934     .     1&lt;br /&gt;
8    2     LEU     HD1     H    0.688     .     1&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example LACS ouput  ===&lt;br /&gt;
&lt;br /&gt;
The CA correction of -0.19 ppm is found (last line). &lt;br /&gt;
&amp;lt;pre&amp;gt;data_LACS&lt;br /&gt;
&lt;br /&gt;
         #################################&lt;br /&gt;
         #    LACS Output Information    #&lt;br /&gt;
         #################################&lt;br /&gt;
&lt;br /&gt;
############################################################&lt;br /&gt;
#              LACS Designator Definition                  #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#   Index Value                    Definition              #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#        0                          Outliers               #&lt;br /&gt;
#        1                        Normal points            #&lt;br /&gt;
#                                                          # &lt;br /&gt;
############################################################            &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
save_LACS_CACB_CA_output&lt;br /&gt;
 _LACS_plot.Sf_category                   LACS_output&lt;br /&gt;
 _LACS_plot.Input_file_name               &amp;quot;data.txt&amp;quot;&lt;br /&gt;
&lt;br /&gt;
 _LACS_plot.X_coord_name                  CA-CB&lt;br /&gt;
 _LACS_plot.Y_coord_name                  CA&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_1     -6.35&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_1     -2.37&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_2      1.99&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_2      0.93&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_1     -2.00&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_1     -1.18&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_2      5.76&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_2      4.33&lt;br /&gt;
 _LACS_plot.Y_axis_chem_shift_offset      -0.19&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Practical Experience with Running LACS in the NESG'''  ==&lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triply labeled proteins we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triply labeled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
editing of this entry is in progress (prossi)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=File:Validate_assignments.txt&amp;diff=2119</id>
		<title>File:Validate assignments.txt</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=File:Validate_assignments.txt&amp;diff=2119"/>
		<updated>2009-11-23T20:53:26Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=File:Missing_shifts.txt&amp;diff=2118</id>
		<title>File:Missing shifts.txt</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=File:Missing_shifts.txt&amp;diff=2118"/>
		<updated>2009-11-23T20:53:05Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=File:BMRBParsing.pm&amp;diff=2117</id>
		<title>File:BMRBParsing.pm</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=File:BMRBParsing.pm&amp;diff=2117"/>
		<updated>2009-11-23T20:49:07Z</updated>

		<summary type="html">&lt;p&gt;Prossi: uploaded a new version of &amp;quot;File:BMRBParsing.pm&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2116</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2116"/>
		<updated>2009-11-23T20:47:16Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= '''Introduction'''  =&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite ([http://www.ncbi.nlm.nih.gov/pubmed/14872126 AVS]) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as consistency to IUPAC&amp;amp;nbsp;labeling, chemical shifts that are grossly outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and can be included as part of the Protein Structure Validation Suite (PSVS) run.&amp;amp;nbsp; It is advisable to run any chemical shift validation prior to structure determination steps in order to uncover problems with the assignments that could impact the performance of noesy assignments and structure calculation downstream.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Practical Aspects  ===&lt;br /&gt;
&lt;br /&gt;
A number of version for the standalone AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1). Two perl scripts can be run from any directory on any computer running perl by either pointing to the local AutoAssign script repository directory or by downloading the scripts linked below.&amp;amp;nbsp; Here an example script is provideded that generates the bmrb in 2.1 format directly from the sparky resonance list 'rl' and the protein sequences.&amp;amp;nbsp; The script validates and computes the completeness statistics for the generated chemical shift list.&amp;amp;nbsp; As modifications are made in the sparky project the operation is repeated until a final bmrb file is achieved.&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;pre&amp;gt;/Local/AutoAssign1.14/bin/sparkyRL2bmrb.pl HsR50_bb.rl test_bmrb.bmrb 1 MSPIPLPVTDTDDAWRARIAA&lt;br /&gt;
HRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLF&lt;br /&gt;
VPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDADLEHHHHHH -diasterio&lt;br /&gt;
/Local/AutoAssign1.14/bin/missing_shifts.pl -printstats test_bmrb.bmrb &amp;amp;gt; missing_HsR50_101109&lt;br /&gt;
/Local/AutoAssign1.14/bin/validate_assignments.pl test_bmrb.bmrb &amp;amp;gt; vali_HsR50_101109&lt;br /&gt;
cp test_bmrb.bmrb HsR50_bb.bmrb&lt;br /&gt;
rm test_bmrb.bmrb&amp;lt;/pre&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Three scripts are run: 1)&amp;amp;nbsp; sparkyRL2bmrb.pl, 2) sparkyRL2bmrb.pl, and 3) validate_assignments.pl.&amp;amp;nbsp; In addition, a bmrb parsing module BMRBparsing.pm is called that interprets the sequence in single letter code and numbers the bmrb residues starting from 1.&lt;br /&gt;
&lt;br /&gt;
Newer file versions are available in later versions of the AutoAssign program that should handle bmrb 3.1 format.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Editing in progress &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
PaoLo roSSi&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2087</id>
		<title>AVS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=AVS&amp;diff=2087"/>
		<updated>2009-11-20T19:53:52Z</updated>

		<summary type="html">&lt;p&gt;Prossi: Created page with '= '''Introduction''' =  Assignment validation suite (AVS) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as IUPAC&amp;amp;nbsp;labe…'&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;= '''Introduction''' =&lt;br /&gt;
&lt;br /&gt;
Assignment validation suite (AVS) checks the chemical shifts list in BioMagResBank (BMRB) format for a number of possible problems such as IUPAC&amp;amp;nbsp;labeling errors, chemical shifts that are grossly outside the typical range for the particular atom/residue, and reports useful statistics information about the examined chemical shift set (e.g. percent assignments, number of stereospecifically assigned methlys, percents aromatic sidechain assignments, etc).&amp;amp;nbsp;&amp;amp;nbsp; AVS is run on every chemical shift set that is submitted to the BMRB, and can be included as part of the Protein Structure Validation Suite (PSVS) run.&amp;amp;nbsp; It is advisable to run any chemical shift validation prior to structure determination steps in order to uncover gross problems with the assignments that would impact the performance of noesy assignments and structure calculation downstream.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Practical Aspects&lt;br /&gt;
&lt;br /&gt;
A number of version for the AVS routine exist that are adapted for different bmrb versions&amp;amp;nbsp; (2.1 or 3.1)&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Editing in progress&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
PaoLo roSSi&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Wiki_Tree_Layout&amp;diff=2086</id>
		<title>Wiki Tree Layout</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Wiki_Tree_Layout&amp;diff=2086"/>
		<updated>2009-11-20T19:38:32Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;This outline of the NESG NMR Wiki is designed to expand on the existing &amp;quot;Master Recipe&amp;quot; and should serve as an experience harvesting tool. &lt;br /&gt;
&lt;br /&gt;
*It has a rather broad coverage to facilitate long-tewrm growth and development. Aditional compact aggregator pages may be needed to pesent specific information concisely. &lt;br /&gt;
*There would be separate webs within the wiki: Public(or Main), NESG, and member lab webs. Most common knowlege topics should be public, unless they are specific to NESG &lt;br /&gt;
*We assume that the target audience has some knowledge about NMR and protein structure determination, but make the content useful for training &lt;br /&gt;
*&amp;quot;Resonance Assignment&amp;quot; and &amp;quot;Structure Determination&amp;quot; chaptes would focus on individual software packages. The XEASY resonance assignment tree, as the most complete, would serve as a template for other software. &lt;br /&gt;
*Most chapters should include a &amp;quot;general principles&amp;quot; section.&lt;br /&gt;
&lt;br /&gt;
Please leave your comments/suggestion at the bottom of this page &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
= HTP NMR structure determination  =&lt;br /&gt;
&lt;br /&gt;
== Protein Target Selection, Sample Preparation, and Initial Screening  ==&lt;br /&gt;
&lt;br /&gt;
#[[Target selection|NESG target selection]] - overview of target selection in PSI III &lt;br /&gt;
#[[Bioinformatics with protein sequence]] &lt;br /&gt;
#[[DNA cloning protocols|DNA cloning protocols]]&amp;lt;br&amp;gt; &lt;br /&gt;
#[[Protein purification|Protein expression and purification protocols]]&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
#Sample Optimization &lt;br /&gt;
##[[construct optimization]]&lt;br /&gt;
##[[Buffer optimization]] &lt;br /&gt;
##[[Cofactor optimization]] &lt;br /&gt;
#Initial protein analysis &lt;br /&gt;
##[[SDS page gel]] &lt;br /&gt;
##[[Protein concentration|Protein concentration measurements]] &lt;br /&gt;
##[[Oligomerization Status|Assessment of Oligomerization Status]] &lt;br /&gt;
###[[Gel filtration and light scattering|gel-filtration and light scattering]] &lt;br /&gt;
###[[Sedimentation equilibrium|Sedimentation equilibrium]] &lt;br /&gt;
###[[NMR determined Rotational correlation time]] &lt;br /&gt;
##[[MassSpectrometry|Mass spectrum]] &lt;br /&gt;
##NMR screening &lt;br /&gt;
###[[1D screening|&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H 1D screening]] &lt;br /&gt;
###[[Nhsqc screen|Initial [&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H] HSQC]]&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== NMR Data Collection  ==&lt;br /&gt;
&lt;br /&gt;
#Routine operation &lt;br /&gt;
##[[NMR sample tubes]] &lt;br /&gt;
##[[NMR Sample Preparation]] &lt;br /&gt;
##[[Inserting NMR Sample]] &lt;br /&gt;
##Tuning and matching &lt;br /&gt;
##[[Deuterium Lock]] &lt;br /&gt;
##[[Shimming]] &lt;br /&gt;
##[[Pulse width calibration]] &lt;br /&gt;
##[[Temperature calibration]] &lt;br /&gt;
##[[Chemical shift referencing]] &lt;br /&gt;
#Advanced operation &lt;br /&gt;
##[[Deuterium pulse width calibration and decoupling]] &lt;br /&gt;
#NMR data acquisition for protein structure determination &lt;br /&gt;
##[[Common NMR experiment sets]] &lt;br /&gt;
##Custom NMR experiment setup scripts for VNMRJ &lt;br /&gt;
##1D 1H NMR spectra and 2D [15N, 1H]-HSQC &lt;br /&gt;
##[[Estimation of rotational correlation time]] &lt;br /&gt;
##Estimation of measurement time &lt;br /&gt;
##NMR experiments for spin system identification &lt;br /&gt;
##2D and 3D NOESY &lt;br /&gt;
##Double and triple NMR experiments &lt;br /&gt;
###3D CBCA(CO)NH and HNCACB &lt;br /&gt;
###3D HNCA and HN(CO)CA &lt;br /&gt;
###3D HAHB(CO)NH &lt;br /&gt;
###(4,3)D CABCA(CO)NH and HNCACB &lt;br /&gt;
###(4,3)D HABCAB(CO)NH &lt;br /&gt;
###(H)CCH &lt;br /&gt;
###(H)CCH-TOCSY &lt;br /&gt;
###H(C)CH &lt;br /&gt;
###H(C)CH-TOCSY &lt;br /&gt;
###(4,3)D HCCH &lt;br /&gt;
##Other NMR experiments &lt;br /&gt;
###2D [13C, 1H]-HSQC for 5% 13C-labeled samples &lt;br /&gt;
###2D [15N, 1H]-long-range-HSQC for determination of histidine protomer state &lt;br /&gt;
###MEXICO &lt;br /&gt;
###CLEANEX &lt;br /&gt;
###H-D exchange experiment &lt;br /&gt;
###15N spin relaxation parameters &lt;br /&gt;
#Advanced problems for data collection &lt;br /&gt;
##[[Setting up non-uniformly sampled spectra]] &lt;br /&gt;
###[[NUS giude for Varian|Guide for Varian/BioPack]] &lt;br /&gt;
###[[NUS guide for Bruker according to Arrowsmith group in Toronto|Guide for Bruker/Topspin according to Arrowsmith group]] &lt;br /&gt;
#Maintenance &lt;br /&gt;
##VARIAN &lt;br /&gt;
###Installing and updating &amp;lt;span class=&amp;quot;twikiNewLink&amp;quot;&amp;gt;BioPack&amp;lt;/span&amp;gt; &lt;br /&gt;
###Full Probefile calibration &lt;br /&gt;
###Rebooting the console &lt;br /&gt;
###Cryoprobe conditioning &lt;br /&gt;
##BRUKER&lt;br /&gt;
&lt;br /&gt;
== NMR Data Processing  ==&lt;br /&gt;
&lt;br /&gt;
#General Priciples and Concepts &lt;br /&gt;
##Fourier transformation &lt;br /&gt;
###Zero-filling &lt;br /&gt;
###Apodization &lt;br /&gt;
###Phasing &lt;br /&gt;
###Linear prediction &lt;br /&gt;
###G-matrix Fourier transformation (GFT) &lt;br /&gt;
##Alternatives to Fourier transformation &lt;br /&gt;
###Maximum entropy reconstruction &lt;br /&gt;
###MDD reconstruction &lt;br /&gt;
###... &lt;br /&gt;
#Practical Aspects &lt;br /&gt;
##NMRPIPE &lt;br /&gt;
###&amp;lt;font color=&amp;quot;#000000&amp;quot;&amp;gt;General information&amp;lt;/font&amp;gt; &lt;br /&gt;
###&amp;lt;font color=&amp;quot;#0000ff&amp;quot;&amp;gt;Buffalo's Processing Protocol using NMRpipe&amp;lt;/font&amp;gt; &lt;br /&gt;
##PROSA &lt;br /&gt;
##TOPSPIN &lt;br /&gt;
##[[AGNuS/AutoProc|AGNuS/AutoProc]] &lt;br /&gt;
##UBNMR &lt;br /&gt;
##Spectral format conversion&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== Resonance Assignment  ==&lt;br /&gt;
&lt;br /&gt;
This chapter would focus on individual data analysis and resonance assignment packages, as most people stick to a particular software for entire structure determination projects. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
#[[Principles and concepts]] &lt;br /&gt;
##[[Stable isotope labeling schemes]] &lt;br /&gt;
##[[NMR experiments]] &lt;br /&gt;
###[[Through-bond]] &lt;br /&gt;
###[[Through space]] &lt;br /&gt;
##[[Spin systems]] &lt;br /&gt;
###[[Definitions]] &lt;br /&gt;
###[[Identification]] &lt;br /&gt;
###[[Linking spin systems]] &lt;br /&gt;
###[[Matching onto covalent structure]] &lt;br /&gt;
#[[Practical aspects]] &lt;br /&gt;
##[[Semi-automated protocols]] &lt;br /&gt;
###[[CARA]] &lt;br /&gt;
####[[Spin System Identification with CARA|Spin System Identification in 2D 15N-HSQC and 3D HNNCO]] &lt;br /&gt;
####[[Backbone Assignment with CARA|Backbone Resonance Assignment]] &lt;br /&gt;
####[[HA and HB Assignment with CARA|Assignment of HA and HB Resonances with (4,3)D GFT HABCAB(CO)NHN]] &lt;br /&gt;
####Side Chain Assignment &lt;br /&gt;
#####[[Aliphatic Side Chain Assignment with CARA|Aliphatic side-chain assignment]] &lt;br /&gt;
#####[[Aromatic Side Chain Assignment with CARA|Aromatic side-chain assignment]] &lt;br /&gt;
#####[[Amide Side Chain Assignment with CARA|Amide side-chain assignment]] &lt;br /&gt;
###[[Sparky]] &lt;br /&gt;
###[[XEASY]] &lt;br /&gt;
####[[XEASY Spin system identification|Spin system identification]] &lt;br /&gt;
####[[XEASY Backbone Assignment|Backbone resonance assignment]]'''&amp;lt;br&amp;gt;''' &lt;br /&gt;
#####GFT-based spectra &lt;br /&gt;
######[[HNCACAB/CABCA(CO)NH]] &lt;br /&gt;
#####Conventional spectra &lt;br /&gt;
######[[HNCACB/CBCA(CO)NH]] &lt;br /&gt;
######HNCA/HN(CO)CA &lt;br /&gt;
######HNCO/HN(CA)CO &lt;br /&gt;
######NOESY/TOCSY &lt;br /&gt;
####[[XEASY Side Chain Assignment|Side chain resonance assignment]] &lt;br /&gt;
#####Aliphatic &lt;br /&gt;
######GFT NMR spectra &lt;br /&gt;
#######[[HA and HB Assignment with GFT in XEASY|(4,3)D GFT HABCAB(CO)NHN]] &lt;br /&gt;
#######[[Side chain assignment with aliphatic (4,3)D HCCH-COSY in XEASY|(4,3)D GFT HCCH]] &lt;br /&gt;
######Conventional spectra &lt;br /&gt;
#######HAHB(CO)NH &lt;br /&gt;
#######HCCH-COSY &lt;br /&gt;
#######HCCH-TOCSY &lt;br /&gt;
#######[[Side chain assignment with CN-NOESY in XEASY|Simultaneous NOESY]] &lt;br /&gt;
#######(H)CC-TOCSY-(CO)NH &lt;br /&gt;
#######H(CC-TOCSY-CO)NH &lt;br /&gt;
#####[[Aromatic side chain assignment with Aro-HCCH-COSY in XEASY|Aromatic]] &lt;br /&gt;
######GFT-based spectra &lt;br /&gt;
######Conventional spectra &lt;br /&gt;
#####Other &lt;br /&gt;
######Trp e1 NH and d1 CH &lt;br /&gt;
######[[Met methyl assignment with NOESY|Met e CH3 ]] &lt;br /&gt;
######[[Amide Side Chain assignment with NOESY|Asn d2 and Gln e2 NH2]] &lt;br /&gt;
#####NOESY peak integration &lt;br /&gt;
##Automated protocols &lt;br /&gt;
###[[AutoAssign|AutoAssign]] &lt;br /&gt;
###[[AutoAssign WebServer|AutoAssign server]] &lt;br /&gt;
###[[Abacus|ABACUS]] &lt;br /&gt;
###[[The PINE Server|PINE server]] &lt;br /&gt;
##Validation of resonance assignment &lt;br /&gt;
###[[AVS|Assignment validation suite (AVS)]] &lt;br /&gt;
###[[LACS|Linear analysis of chemical shift (LACS)]] &lt;br /&gt;
##Depositing chemical shifts&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== Structure Calculation and Validation  ==&lt;br /&gt;
&lt;br /&gt;
#[[Structure Calculation and Validation|Principles and concepts]] &lt;br /&gt;
#Practical aspects &lt;br /&gt;
##Structure calculation &lt;br /&gt;
###CYANA &lt;br /&gt;
####[[CYANA|Getting started]] &lt;br /&gt;
####[[FOUND|FOUND]] &lt;br /&gt;
####[[TALOS|TALOS]] &lt;br /&gt;
####[[GLOMSA|GLOMSA]] &lt;br /&gt;
####[[NOE Calibration Using CYANA|NOE calibration]] &lt;br /&gt;
####[[Manual Structure Calculation Using CYANA|Manual structure calculation]] &lt;br /&gt;
####[[Automated NOESY Assignment Using CYANA|Automated NOESY assignment and structure calculation]] &lt;br /&gt;
####[[Structure Calculation With RDC's Using CYANA|Structure calculation with residual dipolar couplings]] (link to REDCAT/PALES,FINDTENSOR, .rdc file, adding ORI to PDB file) &lt;br /&gt;
####[[Homodimer Structure Calculation Using CYANA|Homodimer structure calculations]][[Homodimer Structure Calculation Using CYANA|&amp;lt;br&amp;gt;]] &lt;br /&gt;
###AutoStructure &lt;br /&gt;
####[[AutoStructure/RPF Theory|Theory]] &lt;br /&gt;
####[[AutoStructure|Getting started]] &lt;br /&gt;
####[[CYANA Structure Calculations Using AutoStructure|CYANA run]] &lt;br /&gt;
####[[XPLOR Structure Calculations Using AutoStructure|XPLOR run]] &lt;br /&gt;
####[[Analyzing AutoStructure Output Directories|Analyzing the output]] &lt;br /&gt;
####[[RPF Analysis|RPF/DP scores]] &lt;br /&gt;
####[[Structure Calculation Using AS-DP|Structure calculation using AS-DP]] &lt;br /&gt;
###&amp;quot;Consensus&amp;quot;&amp;amp;nbsp;Approaches &lt;br /&gt;
####[[Overview of Consensus Runs|Overview of Consensus runs]] &lt;br /&gt;
####[[Finding Consensus NOE Assignments|Finding Consensus NOE assignments]] &lt;br /&gt;
####[[Validation of Consensus Run|Validation of Consensus runs]] &lt;br /&gt;
###[[Structure Calculation Using CS-Rosetta|CS-ROSETTA]] &lt;br /&gt;
###[[Structure Calculation Using CS-CP ROSETTA|CS-DP ROSETTA]] &lt;br /&gt;
###[[Structure Calculation Using RDC-ROSETTA|RDC-ROSETTA]] &lt;br /&gt;
###[[RDC-Assisted Dimer Structure Determination|RDC-assisted dimer structure calculation]]&amp;lt;br&amp;gt; &lt;br /&gt;
###Special topics &lt;br /&gt;
####[[Protein-Ligand Complexes|Protein-Ligand complexes]] &lt;br /&gt;
####[[Working With Metal Ions|Metal ions]] &lt;br /&gt;
####[[Working With Dimers|Dimers]] &lt;br /&gt;
####[[Residual Dipolar Couplings in Structure Refinement|Residual Dipolar Couplings]] &lt;br /&gt;
####[[REDCAT|REDCAT]]&amp;amp;nbsp;and [[REDCRAFT|REDCRAFT]] &lt;br /&gt;
####[[Paramagnetic Constraints in Structure Determination|Paramagnetic constraints]] &lt;br /&gt;
##Structure Refinement &lt;br /&gt;
###[[Structure Refinement Using CNS Energy Minimization With Explicit Water|CNS refinement]] &lt;br /&gt;
###[[Structure Refinement Using XPLOR-NIH|XPLOR-NIH refinement]] &lt;br /&gt;
###[[Rosetta High Resolution Protein Structure Refinement Protocol|ROSETTA refinement]] &lt;br /&gt;
##Validation and deposition &lt;br /&gt;
###[[PdbStat|PdbStat]] &lt;br /&gt;
###[[PSVS|PSVS]] &lt;br /&gt;
###[[RPF Analysis|RPF analysis]] &lt;br /&gt;
###[[MolProbity Server|MolProbity server]] &lt;br /&gt;
###[[PDB and BMRB Deposition|PDB and BMRB deposition]] &lt;br /&gt;
###[[ADIT-NMR|ADIT-NMR]] &lt;br /&gt;
###[[HarvestDB|HarvestDB]] &lt;br /&gt;
###[[SPINS|SPINS]]&lt;br /&gt;
&lt;br /&gt;
-- JeffMills - 28 May 2009 &lt;br /&gt;
&lt;br /&gt;
Here are two comments from Guy: &lt;br /&gt;
&lt;br /&gt;
- need to have centralized site for downloading all software that NESG has developed or licensed; this would be a central site for NESG scientists to use to access the latest version of all software &lt;br /&gt;
&lt;br /&gt;
- need to allow outside users to access links to all software (they will need licenses to download) and also to download software from NESG &lt;br /&gt;
&lt;br /&gt;
-- AlexEletski - 13 Jul 2009 &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2085</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2085"/>
		<updated>2009-11-20T19:22:24Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[media:iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; The LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [''U''-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [''U''-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the different number of bound deuterons which affect the value of the carbon to different degree. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Running LACS'''  ==&lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using an edited version of the chemical shift file in bmrb 2.1 format, the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are: &lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
A running [[Media:WR73-ILVFY_111809_4LACS.bmrb|bmrb]] file and text [[Media:LACS_output.txt|output]] example are provided for user's convenience, adhering to the format should provide smooth operation of the server.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example BMRB&amp;amp;nbsp;input for LACS  ===&lt;br /&gt;
&amp;lt;pre&amp;gt; _Mol_residue_sequence&lt;br /&gt;
;&lt;br /&gt;
MLIYKDIFTDDELSSDSFPM&lt;br /&gt;
KLVDDLVYEFKGKHVVRKEG&lt;br /&gt;
EIVLAGSNPSAEEGAEDDGS&lt;br /&gt;
DEHVERGIDIVLNHKLVEMN&lt;br /&gt;
CYEDASMFKAYIKKFMKNVI&lt;br /&gt;
DHMEKNNRDKADVDAFKKKI&lt;br /&gt;
QGWVVSLLAKDRFKNLAFFI&lt;br /&gt;
GERAAEGAENGQVAIIEYRD&lt;br /&gt;
VDGTEVPTLMLVKEAIIEEK&lt;br /&gt;
CLE&lt;br /&gt;
;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
  loop_&lt;br /&gt;
    _Residue_seq_code&lt;br /&gt;
    _Residue_label&lt;br /&gt;
    _Chem_shift_ambiguity_code&lt;br /&gt;
4    1     MET     C     C    170.742     .     1&lt;br /&gt;
5    1     MET     CA     C    54.828     .     1&lt;br /&gt;
6    1     MET     CB     C    32.579     .     1&lt;br /&gt;
7    2     LEU     H     H    8.934     .     1&lt;br /&gt;
8    2     LEU     HD1     H    0.688     .     1&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example LACS ouput  ===&lt;br /&gt;
&lt;br /&gt;
The CA correction of -0.19 ppm is found (last line). &lt;br /&gt;
&amp;lt;pre&amp;gt;data_LACS&lt;br /&gt;
&lt;br /&gt;
         #################################&lt;br /&gt;
         #    LACS Output Information    #&lt;br /&gt;
         #################################&lt;br /&gt;
&lt;br /&gt;
############################################################&lt;br /&gt;
#              LACS Designator Definition                  #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#   Index Value                    Definition              #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#        0                          Outliers               #&lt;br /&gt;
#        1                        Normal points            #&lt;br /&gt;
#                                                          # &lt;br /&gt;
############################################################            &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
save_LACS_CACB_CA_output&lt;br /&gt;
 _LACS_plot.Sf_category                   LACS_output&lt;br /&gt;
 _LACS_plot.Input_file_name               &amp;quot;data.txt&amp;quot;&lt;br /&gt;
&lt;br /&gt;
 _LACS_plot.X_coord_name                  CA-CB&lt;br /&gt;
 _LACS_plot.Y_coord_name                  CA&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_1     -6.35&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_1     -2.37&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_2      1.99&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_2      0.93&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_1     -2.00&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_1     -1.18&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_2      5.76&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_2      4.33&lt;br /&gt;
 _LACS_plot.Y_axis_chem_shift_offset      -0.19&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Practical Experience with Running LACS in the NESG'''  ==&lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triply labeled proteins we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triply labeled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
editing of this entry is in progress (prossi)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=File:Iupac.pdf&amp;diff=2084</id>
		<title>File:Iupac.pdf</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=File:Iupac.pdf&amp;diff=2084"/>
		<updated>2009-11-20T19:21:57Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2083</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2083"/>
		<updated>2009-11-20T19:20:11Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[www.bmrb.wisc.edu/iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; The LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [''U''-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [''U''-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the different number of bound deuterons which affect the value of the carbon to different degree. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Running LACS'''  ==&lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using an edited version of the chemical shift file in bmrb 2.1 format, the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are: &lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
A running [[Media:WR73-ILVFY_111809_4LACS.bmrb|bmrb]] file and text [[Media:LACS_output.txt|output]] example are provided for user's convenience, adhering to the format should provide smooth operation of the server.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example BMRB&amp;amp;nbsp;input for LACS  ===&lt;br /&gt;
&amp;lt;pre&amp;gt; _Mol_residue_sequence&lt;br /&gt;
;&lt;br /&gt;
MLIYKDIFTDDELSSDSFPM&lt;br /&gt;
KLVDDLVYEFKGKHVVRKEG&lt;br /&gt;
EIVLAGSNPSAEEGAEDDGS&lt;br /&gt;
DEHVERGIDIVLNHKLVEMN&lt;br /&gt;
CYEDASMFKAYIKKFMKNVI&lt;br /&gt;
DHMEKNNRDKADVDAFKKKI&lt;br /&gt;
QGWVVSLLAKDRFKNLAFFI&lt;br /&gt;
GERAAEGAENGQVAIIEYRD&lt;br /&gt;
VDGTEVPTLMLVKEAIIEEK&lt;br /&gt;
CLE&lt;br /&gt;
;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
  loop_&lt;br /&gt;
    _Residue_seq_code&lt;br /&gt;
    _Residue_label&lt;br /&gt;
    _Chem_shift_ambiguity_code&lt;br /&gt;
4    1     MET     C     C    170.742     .     1&lt;br /&gt;
5    1     MET     CA     C    54.828     .     1&lt;br /&gt;
6    1     MET     CB     C    32.579     .     1&lt;br /&gt;
7    2     LEU     H     H    8.934     .     1&lt;br /&gt;
8    2     LEU     HD1     H    0.688     .     1&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example LACS ouput  ===&lt;br /&gt;
&lt;br /&gt;
The CA correction of -0.19 ppm is found (last line). &lt;br /&gt;
&amp;lt;pre&amp;gt;data_LACS&lt;br /&gt;
&lt;br /&gt;
         #################################&lt;br /&gt;
         #    LACS Output Information    #&lt;br /&gt;
         #################################&lt;br /&gt;
&lt;br /&gt;
############################################################&lt;br /&gt;
#              LACS Designator Definition                  #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#   Index Value                    Definition              #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#        0                          Outliers               #&lt;br /&gt;
#        1                        Normal points            #&lt;br /&gt;
#                                                          # &lt;br /&gt;
############################################################            &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
save_LACS_CACB_CA_output&lt;br /&gt;
 _LACS_plot.Sf_category                   LACS_output&lt;br /&gt;
 _LACS_plot.Input_file_name               &amp;quot;data.txt&amp;quot;&lt;br /&gt;
&lt;br /&gt;
 _LACS_plot.X_coord_name                  CA-CB&lt;br /&gt;
 _LACS_plot.Y_coord_name                  CA&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_1     -6.35&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_1     -2.37&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_2      1.99&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_2      0.93&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_1     -2.00&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_1     -1.18&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_2      5.76&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_2      4.33&lt;br /&gt;
 _LACS_plot.Y_axis_chem_shift_offset      -0.19&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Practical Experience with Running LACS in the NESG'''  ==&lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triply labeled proteins we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triply labeled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
editing of this entry is in progress (prossi)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2082</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2082"/>
		<updated>2009-11-20T19:18:58Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Www.bmrb.wisc.edu/iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; The LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [''U''-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [''U''-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the different number of bound deuterons which affect the value of the carbon to different degree. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Running LACS'''  ==&lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using an edited version of the chemical shift file in bmrb 2.1 format, the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are: &lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
A running [[Media:WR73-ILVFY_111809_4LACS.bmrb|bmrb]] file and text [[media:LACS_output.txt|output]] example are provided for user's convenience, adhering to the format should provide smooth operation of the server.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example BMRB&amp;amp;nbsp;input for LACS  ===&lt;br /&gt;
&amp;lt;pre&amp;gt; _Mol_residue_sequence&lt;br /&gt;
;&lt;br /&gt;
MLIYKDIFTDDELSSDSFPM&lt;br /&gt;
KLVDDLVYEFKGKHVVRKEG&lt;br /&gt;
EIVLAGSNPSAEEGAEDDGS&lt;br /&gt;
DEHVERGIDIVLNHKLVEMN&lt;br /&gt;
CYEDASMFKAYIKKFMKNVI&lt;br /&gt;
DHMEKNNRDKADVDAFKKKI&lt;br /&gt;
QGWVVSLLAKDRFKNLAFFI&lt;br /&gt;
GERAAEGAENGQVAIIEYRD&lt;br /&gt;
VDGTEVPTLMLVKEAIIEEK&lt;br /&gt;
CLE&lt;br /&gt;
;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
  loop_&lt;br /&gt;
    _Residue_seq_code&lt;br /&gt;
    _Residue_label&lt;br /&gt;
    _Chem_shift_ambiguity_code&lt;br /&gt;
4    1     MET     C     C    170.742     .     1&lt;br /&gt;
5    1     MET     CA     C    54.828     .     1&lt;br /&gt;
6    1     MET     CB     C    32.579     .     1&lt;br /&gt;
7    2     LEU     H     H    8.934     .     1&lt;br /&gt;
8    2     LEU     HD1     H    0.688     .     1&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example LACS ouput  ===&lt;br /&gt;
&lt;br /&gt;
The CA correction of -0.19 ppm is found (last line). &lt;br /&gt;
&amp;lt;pre&amp;gt;data_LACS&lt;br /&gt;
&lt;br /&gt;
         #################################&lt;br /&gt;
         #    LACS Output Information    #&lt;br /&gt;
         #################################&lt;br /&gt;
&lt;br /&gt;
############################################################&lt;br /&gt;
#              LACS Designator Definition                  #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#   Index Value                    Definition              #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#        0                          Outliers               #&lt;br /&gt;
#        1                        Normal points            #&lt;br /&gt;
#                                                          # &lt;br /&gt;
############################################################            &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
save_LACS_CACB_CA_output&lt;br /&gt;
 _LACS_plot.Sf_category                   LACS_output&lt;br /&gt;
 _LACS_plot.Input_file_name               &amp;quot;data.txt&amp;quot;&lt;br /&gt;
&lt;br /&gt;
 _LACS_plot.X_coord_name                  CA-CB&lt;br /&gt;
 _LACS_plot.Y_coord_name                  CA&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_1     -6.35&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_1     -2.37&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_2      1.99&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_2      0.93&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_1     -2.00&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_1     -1.18&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_2      5.76&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_2      4.33&lt;br /&gt;
 _LACS_plot.Y_axis_chem_shift_offset      -0.19&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Practical Experience with Running LACS in the NESG'''  ==&lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triply labeled proteins we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triply labeled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
editing of this entry is in progress (prossi)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2081</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2081"/>
		<updated>2009-11-20T19:18:11Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Www.bmrb.wisc.edu/iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; The LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [''U''-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [''U''-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the different number of bound deuterons which affect the value of the carbon to different degree. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Running LACS'''  ==&lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using an edited version of the chemical shift file in bmrb 2.1 format, the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are: &lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
A running [[media:WR73-ILVFY_111809_4LACS.bmrb|bmrb]] file and text output example are provided for user's convenience, adhering to the format should provide smooth operation of the server.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example BMRB&amp;amp;nbsp;input for LACS  ===&lt;br /&gt;
&amp;lt;pre&amp;gt; _Mol_residue_sequence&lt;br /&gt;
;&lt;br /&gt;
MLIYKDIFTDDELSSDSFPM&lt;br /&gt;
KLVDDLVYEFKGKHVVRKEG&lt;br /&gt;
EIVLAGSNPSAEEGAEDDGS&lt;br /&gt;
DEHVERGIDIVLNHKLVEMN&lt;br /&gt;
CYEDASMFKAYIKKFMKNVI&lt;br /&gt;
DHMEKNNRDKADVDAFKKKI&lt;br /&gt;
QGWVVSLLAKDRFKNLAFFI&lt;br /&gt;
GERAAEGAENGQVAIIEYRD&lt;br /&gt;
VDGTEVPTLMLVKEAIIEEK&lt;br /&gt;
CLE&lt;br /&gt;
;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
  loop_&lt;br /&gt;
    _Residue_seq_code&lt;br /&gt;
    _Residue_label&lt;br /&gt;
    _Chem_shift_ambiguity_code&lt;br /&gt;
4    1     MET     C     C    170.742     .     1&lt;br /&gt;
5    1     MET     CA     C    54.828     .     1&lt;br /&gt;
6    1     MET     CB     C    32.579     .     1&lt;br /&gt;
7    2     LEU     H     H    8.934     .     1&lt;br /&gt;
8    2     LEU     HD1     H    0.688     .     1&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
=== Example LACS ouput  ===&lt;br /&gt;
&lt;br /&gt;
The CA correction of -0.19 ppm is found (last line). &lt;br /&gt;
&amp;lt;pre&amp;gt;data_LACS&lt;br /&gt;
&lt;br /&gt;
         #################################&lt;br /&gt;
         #    LACS Output Information    #&lt;br /&gt;
         #################################&lt;br /&gt;
&lt;br /&gt;
############################################################&lt;br /&gt;
#              LACS Designator Definition                  #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#   Index Value                    Definition              #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#        0                          Outliers               #&lt;br /&gt;
#        1                        Normal points            #&lt;br /&gt;
#                                                          # &lt;br /&gt;
############################################################            &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
save_LACS_CACB_CA_output&lt;br /&gt;
 _LACS_plot.Sf_category                   LACS_output&lt;br /&gt;
 _LACS_plot.Input_file_name               &amp;quot;data.txt&amp;quot;&lt;br /&gt;
&lt;br /&gt;
 _LACS_plot.X_coord_name                  CA-CB&lt;br /&gt;
 _LACS_plot.Y_coord_name                  CA&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_1     -6.35&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_1     -2.37&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_2      1.99&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_2      0.93&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_1     -2.00&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_1     -1.18&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_2      5.76&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_2      4.33&lt;br /&gt;
 _LACS_plot.Y_axis_chem_shift_offset      -0.19&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== '''Practical Experience with Running LACS in the NESG'''  ==&lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triply labeled proteins we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triply labeled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
editing of this entry is in progress (prossi)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=File:LACS_output.txt&amp;diff=2080</id>
		<title>File:LACS output.txt</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=File:LACS_output.txt&amp;diff=2080"/>
		<updated>2009-11-20T19:16:37Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=File:WR73-ILVFY_111809_4LACS.bmrb&amp;diff=2079</id>
		<title>File:WR73-ILVFY 111809 4LACS.bmrb</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=File:WR73-ILVFY_111809_4LACS.bmrb&amp;diff=2079"/>
		<updated>2009-11-20T19:14:27Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2078</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2078"/>
		<updated>2009-11-20T19:13:46Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction'''  ==&lt;br /&gt;
&lt;br /&gt;
Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Www.bmrb.wisc.edu/iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; The LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [''U''-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [''U''-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the different number of bound deuterons which affect the value of the carbon to different degree. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Running LACS'''  ==&lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using an edited version of the chemical shift file in bmrb 2.1 format, the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are: &lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
A running bmrb file and text output example are provided for user's convenience, adhering to the format should provide smooth operation of the server.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=== Example BMRB&amp;amp;nbsp;input for LACS  ===&lt;br /&gt;
&amp;lt;pre&amp;gt; _Mol_residue_sequence&lt;br /&gt;
;&lt;br /&gt;
MLIYKDIFTDDELSSDSFPM&lt;br /&gt;
KLVDDLVYEFKGKHVVRKEG&lt;br /&gt;
EIVLAGSNPSAEEGAEDDGS&lt;br /&gt;
DEHVERGIDIVLNHKLVEMN&lt;br /&gt;
CYEDASMFKAYIKKFMKNVI&lt;br /&gt;
DHMEKNNRDKADVDAFKKKI&lt;br /&gt;
QGWVVSLLAKDRFKNLAFFI&lt;br /&gt;
GERAAEGAENGQVAIIEYRD&lt;br /&gt;
VDGTEVPTLMLVKEAIIEEK&lt;br /&gt;
CLE&lt;br /&gt;
;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
  loop_&lt;br /&gt;
    _Residue_seq_code&lt;br /&gt;
    _Residue_label&lt;br /&gt;
    _Chem_shift_ambiguity_code&lt;br /&gt;
4    1     MET     C     C    170.742     .     1&lt;br /&gt;
5    1     MET     CA     C    54.828     .     1&lt;br /&gt;
6    1     MET     CB     C    32.579     .     1&lt;br /&gt;
7    2     LEU     H     H    8.934     .     1&lt;br /&gt;
8    2     LEU     HD1     H    0.688     .     1&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=== Example LACS ouput  ===&lt;br /&gt;
&lt;br /&gt;
The CA correction of -0.19 ppm is found (last line). &lt;br /&gt;
&amp;lt;pre&amp;gt;data_LACS&lt;br /&gt;
&lt;br /&gt;
         #################################&lt;br /&gt;
         #    LACS Output Information    #&lt;br /&gt;
         #################################&lt;br /&gt;
&lt;br /&gt;
############################################################&lt;br /&gt;
#              LACS Designator Definition                  #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#   Index Value                    Definition              #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#        0                          Outliers               #&lt;br /&gt;
#        1                        Normal points            #&lt;br /&gt;
#                                                          # &lt;br /&gt;
############################################################            &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
save_LACS_CACB_CA_output&lt;br /&gt;
 _LACS_plot.Sf_category                   LACS_output&lt;br /&gt;
 _LACS_plot.Input_file_name               &amp;quot;data.txt&amp;quot;&lt;br /&gt;
&lt;br /&gt;
 _LACS_plot.X_coord_name                  CA-CB&lt;br /&gt;
 _LACS_plot.Y_coord_name                  CA&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_1     -6.35&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_1     -2.37&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_2      1.99&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_2      0.93&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_1     -2.00&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_1     -1.18&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_2      5.76&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_2      4.33&lt;br /&gt;
 _LACS_plot.Y_axis_chem_shift_offset      -0.19&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
== '''Practical Experience with Running LACS in the NESG'''  ==&lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triply labeled proteins we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triply labeled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
editing of this entry is in progress (prossi)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2077</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2077"/>
		<updated>2009-11-20T19:12:08Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Introduction''' ==&lt;br /&gt;
&lt;br /&gt;
Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Www.bmrb.wisc.edu/iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB).&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; The LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [''U''-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [''U''-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the different number of bound deuterons which affect the value of the carbon to different degree. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
== '''Running LACS''' ==&lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using an edited version of the chemical shift file in bmrb 2.1 format, the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are: &lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
A running bmrb file and text output example are provided for user's convenience, adhering to the format should provide smooth operation of the server.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Example BMRB&amp;amp;nbsp;input for LACS:&lt;br /&gt;
&amp;lt;pre&amp;gt; _Mol_residue_sequence&lt;br /&gt;
;&lt;br /&gt;
MLIYKDIFTDDELSSDSFPM&lt;br /&gt;
KLVDDLVYEFKGKHVVRKEG&lt;br /&gt;
EIVLAGSNPSAEEGAEDDGS&lt;br /&gt;
DEHVERGIDIVLNHKLVEMN&lt;br /&gt;
CYEDASMFKAYIKKFMKNVI&lt;br /&gt;
DHMEKNNRDKADVDAFKKKI&lt;br /&gt;
QGWVVSLLAKDRFKNLAFFI&lt;br /&gt;
GERAAEGAENGQVAIIEYRD&lt;br /&gt;
VDGTEVPTLMLVKEAIIEEK&lt;br /&gt;
CLE&lt;br /&gt;
;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
  loop_&lt;br /&gt;
    _Residue_seq_code&lt;br /&gt;
    _Residue_label&lt;br /&gt;
    _Chem_shift_ambiguity_code&lt;br /&gt;
4    1     MET     C     C    170.742     .     1&lt;br /&gt;
5    1     MET     CA     C    54.828     .     1&lt;br /&gt;
6    1     MET     CB     C    32.579     .     1&lt;br /&gt;
7    2     LEU     H     H    8.934     .     1&lt;br /&gt;
8    2     LEU     HD1     H    0.688     .     1&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
Example LACS ouput:&lt;br /&gt;
&lt;br /&gt;
The CA correction of -0.19 ppm is found (last line).&lt;br /&gt;
&amp;lt;pre&amp;gt;data_LACS&lt;br /&gt;
&lt;br /&gt;
         #################################&lt;br /&gt;
         #    LACS Output Information    #&lt;br /&gt;
         #################################&lt;br /&gt;
&lt;br /&gt;
############################################################&lt;br /&gt;
#              LACS Designator Definition                  #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#   Index Value                    Definition              #&lt;br /&gt;
#                                                          #&lt;br /&gt;
#        0                          Outliers               #&lt;br /&gt;
#        1                        Normal points            #&lt;br /&gt;
#                                                          # &lt;br /&gt;
############################################################            &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
save_LACS_CACB_CA_output&lt;br /&gt;
 _LACS_plot.Sf_category                   LACS_output&lt;br /&gt;
 _LACS_plot.Input_file_name               &amp;quot;data.txt&amp;quot;&lt;br /&gt;
&lt;br /&gt;
 _LACS_plot.X_coord_name                  CA-CB&lt;br /&gt;
 _LACS_plot.Y_coord_name                  CA&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_1     -6.35&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_1     -2.37&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_x_2      1.99&lt;br /&gt;
 _LACS_plot.Line_1_terminator_val_y_2      0.93&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_1     -2.00&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_1     -1.18&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_x_2      5.76&lt;br /&gt;
 _LACS_plot.Line_2_terminator_val_y_2      4.33&lt;br /&gt;
 _LACS_plot.Y_axis_chem_shift_offset      -0.19&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/pre&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
== '''Practical Experience with Running LACS in the NESG''' ==&lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triply labeled proteins we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triply labeled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
editing of this entry is in progress (prossi)&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
-- PaoloRossi - 20 Nov 2009&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2066</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2066"/>
		<updated>2009-11-20T17:48:19Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Www.bmrb.wisc.edu/iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB) &amp;amp;nbsp; In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Therefore, successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [U-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [U-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the number of bound deuterons. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using a chemical shift file in bmrb 2.1 format and the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
The items returned are:&lt;br /&gt;
&lt;br /&gt;
i) a text file with the nucleus specific offsets from the linear fit of the secondary CS&amp;amp;nbsp; (e. g. deltaCA vs. deltaCA-deltaCB), obtained by subtracting the random coil value from the atom of interest. &lt;br /&gt;
&lt;br /&gt;
ii) plots of the secondary CS outliers that may reveal incorrectly assigned residues. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
A running bmrb file and text output example are provided for user's convenience, adhering to the format should provide smooth operation of the server. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10 - 40 °C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triple labeled samples we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially for the treatment of triple labeled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
editing of this entry is in progress (prossi)&amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2056</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2056"/>
		<updated>2009-11-20T17:17:31Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Www.bmrb.wisc.edu/iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB) &amp;amp;nbsp; In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Therefore, successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [U-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [U-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the number of bound deuterons. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native [http://bija.nmrfam.wisc.edu/MANI-LACS/ server] using a chemical shift file in bmrb 2.1 format and the user's email and project name.&amp;amp;nbsp; The server returns the results very rapidly, the chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; A running bmrb file and output example are provided for user's convenience, adhering to the format should provide smooth operation of the server. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10-30 deg C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triple labeled samples we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially fro treatment of triple labelled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2055</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2055"/>
		<updated>2009-11-20T17:15:34Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[Www.bmrb.wisc.edu/iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; LACS is routinely run on all chemical shift sets submitted to the BioMagResBank (BMRB) &amp;amp;nbsp; In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone chemical shift derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and are used as constraints in the structure determination process. The backbone shift set (CA, CB, CO, HN, N, HA) is also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Here fragments are selected from the protein databank (PDB) that have the same predicted CS as the query sequence.&amp;amp;nbsp; Therefore, successful use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; LACS server gives independent CS offsets for CA, CB, CO and HA and allows for effective correction of chemical shift sets derived from [U-&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N] and from [U-&amp;lt;sup&amp;gt;2&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C,&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N].&amp;amp;nbsp; The latter labeling scheme may show distinct degrees of offset for CA and CB due to the number of bound deuterons. &amp;amp;nbsp;&amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
LACS&amp;amp;nbsp;can be run on the native server using a chemical shift file in bmrb 2.1 format and the user's email and project name.&amp;amp;nbsp; The server returns the results within a few minutes when the correct chemical shift format are provided.&amp;amp;nbsp; The chemical shift file format is stringent and the output is of straight forward interpretation.&amp;amp;nbsp; A running bmrb file and output example are provided for user's convenience, adhering to the format should provide smooth operation of the server. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
In the NESG the IUPAC&amp;amp;nbsp;referencing is obtained using internal 50 uM DSS and setting the DSS&amp;amp;nbsp;methyl peak to 0.00 ppm at the temperature of interest.&amp;amp;nbsp; The spectrometer temperature is calibrated using a neat methanol sample in the 10-30 deg C range.&amp;amp;nbsp; Under these conditions, backbone CS of double labeled protein samples derived from triple resonance experiments alone typically show small deviations 0.1 - 0.3 ppm in &amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C and 0.01 - 0.03 ppm in &amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H.&amp;amp;nbsp; The final CS set derived from double labeled samples filtered through higher resolution [&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H,&amp;lt;sup&amp;gt;13&amp;lt;/sup&amp;gt;C]-HSQC tends to give offsets at the lower extreme of this range.&amp;amp;nbsp; On a smaller statistical sampling of triple labeled samples we found higher offset values (0.4 - 0.8 ppm) in CA and CB.&amp;amp;nbsp; Offsett correction prior to TALOS&amp;amp;nbsp;or MFR runs are therefore highly recommended especially fro treatment of triple labelled samples. &amp;amp;nbsp; &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2046</id>
		<title>LACS</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=LACS&amp;diff=2046"/>
		<updated>2009-11-20T16:19:28Z</updated>

		<summary type="html">&lt;p&gt;Prossi: Created page with 'Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute referencing of p…'&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Linear analysis of chemical shift ([http://www.ncbi.nlm.nih.gov/pubmed/16041479 LACS]) provides an independent means for absolute [[www.bmrb.wisc.edu/iupac.pdf|referencing]] of protein chemical shifts.&amp;amp;nbsp; In the contest of protein structure determination chemical shifts (CS) play a key role as reporters of secondary structure.&amp;amp;nbsp; Backbone CS-derived dihedral angles can be obtained through programs such as [http://www.ncbi.nlm.nih.gov/pubmed/19548092 TALOS+] and others are used as constraints in the structure determination process, backbone shift set (CA, CB, CO, HN, N, HA) are also used in the molecular fragment selection (MFR) for [http://www.ncbi.nlm.nih.gov/pubmed/18326625 CS-Rosetta] structure prediction protocol.&amp;amp;nbsp; Any use of chemical shift for secondary structure inference requires the correct referencing.&amp;amp;nbsp; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Wiki_Tree_Layout&amp;diff=2043</id>
		<title>Wiki Tree Layout</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Wiki_Tree_Layout&amp;diff=2043"/>
		<updated>2009-11-20T15:45:04Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;This outline of the NESG NMR Wiki is designed to expand on the existing &amp;quot;Master Recipe&amp;quot; and should serve as an experience harvesting tool. &lt;br /&gt;
&lt;br /&gt;
*It has a rather broad coverage to facilitate long-tewrm growth and development. Aditional compact aggregator pages may be needed to pesent specific information concisely. &lt;br /&gt;
*There would be separate webs within the wiki: Public(or Main), NESG, and member lab webs. Most common knowlege topics should be public, unless they are specific to NESG &lt;br /&gt;
*We assume that the target audience has some knowledge about NMR and protein structure determination, but make the content useful for training &lt;br /&gt;
*&amp;quot;Resonance Assignment&amp;quot; and &amp;quot;Structure Determination&amp;quot; chaptes would focus on individual software packages. The XEASY resonance assignment tree, as the most complete, would serve as a template for other software. &lt;br /&gt;
*Most chapters should include a &amp;quot;general principles&amp;quot; section.&lt;br /&gt;
&lt;br /&gt;
Please leave your comments/suggestion at the bottom of this page &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
= HTP NMR structure determination  =&lt;br /&gt;
&lt;br /&gt;
== Protein Target Selection, Sample Preparation, and Initial Screening  ==&lt;br /&gt;
&lt;br /&gt;
#[[Target selection|NESG target selection]] - overview of target selection in PSI III &lt;br /&gt;
#[[Bioinformatics with protein sequence]] &lt;br /&gt;
#[[DNA cloning protocols|DNA cloning protocols]]&amp;lt;br&amp;gt; &lt;br /&gt;
#[[Protein purification|Protein expression and purification protocols]]&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
#Sample Optimization &lt;br /&gt;
##[[construct optimization]]&lt;br /&gt;
##[[Buffer optimization]] &lt;br /&gt;
##[[Cofactor optimization]] &lt;br /&gt;
#Initial protein analysis &lt;br /&gt;
##[[SDS page gel]] &lt;br /&gt;
##[[Protein concentration|Protein concentration measurements]] &lt;br /&gt;
##[[Oligomerization Status|Assessment of Oligomerization Status]] &lt;br /&gt;
###[[Gel filtration and light scattering|gel-filtration and light scattering]] &lt;br /&gt;
###[[Sedimentation equilibrium|Sedimentation equilibrium]] &lt;br /&gt;
###[[NMR determined Rotational correlation time]] &lt;br /&gt;
##[[MassSpectrometry|Mass spectrum]] &lt;br /&gt;
##NMR screening &lt;br /&gt;
###[[1D screening|&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H 1D screening]] &lt;br /&gt;
###[[Nhsqc screen|Initial [&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H] HSQC]]&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== NMR Data Collection  ==&lt;br /&gt;
&lt;br /&gt;
#Routine operation &lt;br /&gt;
##[[NMR sample tubes]] &lt;br /&gt;
##[[NMR Sample Preparation]] &lt;br /&gt;
##[[Inserting NMR Sample]] &lt;br /&gt;
##Tuning and matching &lt;br /&gt;
##[[Deuterium Lock]] &lt;br /&gt;
##[[Shimming]] &lt;br /&gt;
##[[Pulse width calibration]] &lt;br /&gt;
##[[Temperature calibration]] &lt;br /&gt;
##[[Chemical shift referencing]] &lt;br /&gt;
#Advanced operation &lt;br /&gt;
##[[Deuterium pulse width calibration and decoupling]] &lt;br /&gt;
#NMR data acquisition for protein structure determination &lt;br /&gt;
##[[Common NMR experiment sets]] &lt;br /&gt;
##Custom NMR experiment setup scripts for VNMRJ &lt;br /&gt;
##1D 1H NMR spectra and 2D [15N, 1H]-HSQC &lt;br /&gt;
##[[Estimation of rotational correlation time]]&lt;br /&gt;
##Estimation of measurement time &lt;br /&gt;
##NMR experiments for spin system identification &lt;br /&gt;
##2D and 3D NOESY &lt;br /&gt;
##Double and triple NMR experiments &lt;br /&gt;
###3D CBCA(CO)NH and HNCACB &lt;br /&gt;
###3D HNCA and HN(CO)CA &lt;br /&gt;
###3D HAHB(CO)NH &lt;br /&gt;
###(4,3)D CABCA(CO)NH and HNCACB &lt;br /&gt;
###(4,3)D HABCAB(CO)NH &lt;br /&gt;
###(H)CCH &lt;br /&gt;
###(H)CCH-TOCSY &lt;br /&gt;
###H(C)CH &lt;br /&gt;
###H(C)CH-TOCSY &lt;br /&gt;
###(4,3)D HCCH &lt;br /&gt;
##Other NMR experiments &lt;br /&gt;
###2D [13C, 1H]-HSQC for 5% 13C-labeled samples &lt;br /&gt;
###2D [15N, 1H]-long-range-HSQC for determination of histidine protomer state &lt;br /&gt;
###MEXICO &lt;br /&gt;
###CLEANEX &lt;br /&gt;
###H-D exchange experiment &lt;br /&gt;
###15N spin relaxation parameters &lt;br /&gt;
#Advanced problems for data collection &lt;br /&gt;
##Setting up non-uniformly sampled spectra &lt;br /&gt;
###Guide for Varian/BioPack &lt;br /&gt;
###Guide for Bruker according to Arrowsmith group &lt;br /&gt;
#Maintenance &lt;br /&gt;
##VARIAN &lt;br /&gt;
###Installing and updating &amp;lt;span class=&amp;quot;twikiNewLink&amp;quot;&amp;gt;BioPack&amp;lt;/span&amp;gt; &lt;br /&gt;
###Full Probefile calibration &lt;br /&gt;
###Rebooting the console &lt;br /&gt;
###Cryoprobe conditioning &lt;br /&gt;
##BRUKER&lt;br /&gt;
&lt;br /&gt;
== NMR Data Processing  ==&lt;br /&gt;
&lt;br /&gt;
#General Priciples and Concepts &lt;br /&gt;
##Fourier transformation &lt;br /&gt;
###Zero-filling &lt;br /&gt;
###Apodization &lt;br /&gt;
###Phasing &lt;br /&gt;
###Linear prediction &lt;br /&gt;
###G-matrix Fourier transformation (GFT) &lt;br /&gt;
##Alternatives to Fourier transformation &lt;br /&gt;
###Maximum entropy reconstruction &lt;br /&gt;
###MDD reconstruction &lt;br /&gt;
###... &lt;br /&gt;
#Practical Aspects &lt;br /&gt;
##NMRPIPE &lt;br /&gt;
###&amp;lt;font color=&amp;quot;#000000&amp;quot;&amp;gt;General information&amp;lt;/font&amp;gt; &lt;br /&gt;
###&amp;lt;font color=&amp;quot;#0000ff&amp;quot;&amp;gt;Buffalo's Processing Protocol using NMRpipe&amp;lt;/font&amp;gt; &lt;br /&gt;
##PROSA &lt;br /&gt;
##TOPSPIN &lt;br /&gt;
##[[AGNuS/AutoProc|AGNuS/AutoProc]] &lt;br /&gt;
##UBNMR &lt;br /&gt;
##Spectral format conversion&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== Resonance Assignment  ==&lt;br /&gt;
&lt;br /&gt;
This chapter would focus on individual data analysis and resonance assignment packages, as most people stick to a particular software for entire structure determination projects. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
#[[Principles and concepts]] &lt;br /&gt;
##[[Stable isotope labeling schemes]] &lt;br /&gt;
##[[NMR experiments]] &lt;br /&gt;
###[[Through-bond]] &lt;br /&gt;
###[[Through space]] &lt;br /&gt;
##[[Spin systems]] &lt;br /&gt;
###[[Definitions]] &lt;br /&gt;
###[[Identification]] &lt;br /&gt;
###[[Linking spin systems]] &lt;br /&gt;
###[[Matching onto covalent structure]] &lt;br /&gt;
#[[Practical aspects]] &lt;br /&gt;
##[[Semi-automated protocols]] &lt;br /&gt;
###[[CARA]] &lt;br /&gt;
####[[Spin System Identification with CARA|Spin System Identification in 2D 15N-HSQC and 3D HNNCO]] &lt;br /&gt;
####[[Backbone Assignment with CARA|Backbone Resonance Assignment]] &lt;br /&gt;
####[[HA and HB Assignment with CARA|Assignment of HA and HB Resonances with (4,3)D GFT HABCAB(CO)NHN]] &lt;br /&gt;
####Side Chain Assignment &lt;br /&gt;
#####[[Aliphatic Side Chain Assignment with CARA|Aliphatic side-chain assignment]] &lt;br /&gt;
#####[[Aromatic Side Chain Assignment with CARA|Aromatic side-chain assignment]] &lt;br /&gt;
#####[[Amide Side Chain Assignment with CARA|Amide side-chain assignment]] &lt;br /&gt;
###[[Sparky]] &lt;br /&gt;
###[[XEASY]] &lt;br /&gt;
####[[XEASY Spin system identification|Spin system identification]] &lt;br /&gt;
####[[XEASY Backbone Assignment|Backbone resonance assignment]]'''&amp;lt;br&amp;gt;''' &lt;br /&gt;
#####GFT-based spectra &lt;br /&gt;
######[[HNCACAB/CABCA(CO)NH]] &lt;br /&gt;
#####Conventional spectra &lt;br /&gt;
######[[HNCACB/CBCA(CO)NH]] &lt;br /&gt;
######HNCA/HN(CO)CA &lt;br /&gt;
######HNCO/HN(CA)CO &lt;br /&gt;
######NOESY/TOCSY &lt;br /&gt;
####[[XEASY Side Chain Assignment|Side chain resonance assignment]] &lt;br /&gt;
#####Aliphatic &lt;br /&gt;
######GFT NMR spectra &lt;br /&gt;
#######[[HA and HB Assignment with GFT in XEASY|(4,3)D GFT HABCAB(CO)NHN]] &lt;br /&gt;
#######[[Side chain assignment with aliphatic (4,3)D HCCH-COSY in XEASY|(4,3)D GFT HCCH]] &lt;br /&gt;
######Conventional spectra &lt;br /&gt;
#######HAHB(CO)NH &lt;br /&gt;
#######HCCH-COSY &lt;br /&gt;
#######HCCH-TOCSY &lt;br /&gt;
#######[[Side chain assignment with CN-NOESY in XEASY|Simultaneous NOESY]] &lt;br /&gt;
#######(H)CC-TOCSY-(CO)NH &lt;br /&gt;
#######H(CC-TOCSY-CO)NH &lt;br /&gt;
#####[[Aromatic side chain assignment with Aro-HCCH-COSY in XEASY|Aromatic]] &lt;br /&gt;
######GFT-based spectra &lt;br /&gt;
######Conventional spectra &lt;br /&gt;
#####Other &lt;br /&gt;
######Trp e1 NH and d1 CH &lt;br /&gt;
######[[Met methyl assignment with NOESY|Met e CH3 ]] &lt;br /&gt;
######[[Amide Side Chain assignment with NOESY|Asn d2 and Gln e2 NH2]] &lt;br /&gt;
#####NOESY peak integration &lt;br /&gt;
##Automated protocols &lt;br /&gt;
###[[AutoAssign|AutoAssign]] &lt;br /&gt;
###[[AutoAssign WebServer|AutoAssign server]] &lt;br /&gt;
###[[Abacus|ABACUS]] &lt;br /&gt;
###[[The PINE Server|PINE server]] &lt;br /&gt;
##Validation of resonance assignment &lt;br /&gt;
###[[AVS|AVSx]] &lt;br /&gt;
###[[LACS|Linear analysis of chemical shift (LACS)]] &lt;br /&gt;
##Depositing chemical shifts&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== Structure Calculation and Validation  ==&lt;br /&gt;
&lt;br /&gt;
#[[Structure Calculation and Validation|Principles and concepts]] &lt;br /&gt;
#Practical aspects &lt;br /&gt;
##Structure calculation &lt;br /&gt;
###CYANA &lt;br /&gt;
####[[CYANA|Getting started]] &lt;br /&gt;
####[[FOUND|FOUND]] &lt;br /&gt;
####[[TALOS|TALOS]] &lt;br /&gt;
####[[GLOMSA|GLOMSA]] &lt;br /&gt;
####[[NOE Calibration Using CYANA|NOE calibration]] &lt;br /&gt;
####[[Manual Structure Calculation Using CYANA|Manual structure calculation]] &lt;br /&gt;
####[[Automated NOESY Assignment Using CYANA|Automated NOESY assignment and structure calculation]] &lt;br /&gt;
####[[Structure Calculation With RDC's Using CYANA|Structure calculation with residual dipolar couplings]] (link to REDCAT/PALES,FINDTENSOR, .rdc file, adding ORI to PDB file) &lt;br /&gt;
####[[Homodimer Structure Calculation Using CYANA|Homodimer structure calculations]][[Homodimer Structure Calculation Using CYANA|&amp;lt;br&amp;gt;]] &lt;br /&gt;
###AutoStructure &lt;br /&gt;
####[[AutoStructure/RPF Theory|Theory]] &lt;br /&gt;
####[[AutoStructure|Getting started]] &lt;br /&gt;
####[[CYANA Structure Calculations Using AutoStructure|CYANA run]] &lt;br /&gt;
####[[XPLOR Structure Calculations Using AutoStructure|XPLOR run]] &lt;br /&gt;
####[[Analyzing AutoStructure Output Directories|Analyzing the output]] &lt;br /&gt;
####[[RPF Analysis|RPF/DP scores]] &lt;br /&gt;
####[[Structure Calculation Using AS-DP|Structure calculation using AS-DP]] &lt;br /&gt;
###&amp;quot;Consensus&amp;quot;&amp;amp;nbsp;Approaches &lt;br /&gt;
####[[Overview of Consensus Runs|Overview of Consensus runs]] &lt;br /&gt;
####[[Finding Consensus NOE Assignments|Finding Consensus NOE assignments]] &lt;br /&gt;
####[[Validation of Consensus Run|Validation of Consensus runs]] &lt;br /&gt;
###[[Structure Calculation Using CS-Rosetta|CS-ROSETTA]] &lt;br /&gt;
###[[Structure Calculation Using CS-CP ROSETTA|CS-DP ROSETTA]] &lt;br /&gt;
###[[Structure Calculation Using RDC-ROSETTA|RDC-ROSETTA]] &lt;br /&gt;
###[[RDC-Assisted Dimer Structure Determination|RDC-assisted dimer structure calculation]]&amp;lt;br&amp;gt; &lt;br /&gt;
###Special topics &lt;br /&gt;
####[[Protein-Ligand Complexes|Protein-Ligand complexes]] &lt;br /&gt;
####[[Working With Metal Ions|Metal ions]] &lt;br /&gt;
####[[Working With Dimers|Dimers]] &lt;br /&gt;
####[[Residual Dipolar Couplings in Structure Refinement|Residual Dipolar Couplings]] &lt;br /&gt;
####[[REDCAT|REDCAT]]&amp;amp;nbsp;and [[REDCRAFT|REDCRAFT]] &lt;br /&gt;
####[[Paramagnetic Constraints in Structure Determination|Paramagnetic constraints]] &lt;br /&gt;
##Structure Refinement &lt;br /&gt;
###[[Structure Refinement Using CNS Energy Minimization With Explicit Water|CNS refinement]] &lt;br /&gt;
###[[Structure Refinement Using XPLOR-NIH|XPLOR-NIH refinement]] &lt;br /&gt;
###[[Rosetta High Resolution Protein Structure Refinement Protocol|ROSETTA refinement]] &lt;br /&gt;
##Validation and deposition &lt;br /&gt;
###[[PdbStat|PdbStat]] &lt;br /&gt;
###[[PSVS|PSVS]] &lt;br /&gt;
###[[RPF Analysis|RPF analysis]] &lt;br /&gt;
###[[MolProbity Server|MolProbity server]] &lt;br /&gt;
###[[PDB and BMRB Deposition|PDB and BMRB deposition]] &lt;br /&gt;
###[[ADIT-NMR|ADIT-NMR]] &lt;br /&gt;
###[[HarvestDB|HarvestDB]] &lt;br /&gt;
###[[SPINS|SPINS]]&lt;br /&gt;
&lt;br /&gt;
-- JeffMills - 28 May 2009 &lt;br /&gt;
&lt;br /&gt;
Here are two comments from Guy: &lt;br /&gt;
&lt;br /&gt;
- need to have centralized site for downloading all software that NESG has developed or licensed; this would be a central site for NESG scientists to use to access the latest version of all software &lt;br /&gt;
&lt;br /&gt;
- need to allow outside users to access links to all software (they will need licenses to download) and also to download software from NESG &lt;br /&gt;
&lt;br /&gt;
-- AlexEletski - 13 Jul 2009 &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Wiki_Tree_Layout&amp;diff=2039</id>
		<title>Wiki Tree Layout</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Wiki_Tree_Layout&amp;diff=2039"/>
		<updated>2009-11-20T15:35:58Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;This outline of the NESG NMR Wiki is designed to expand on the existing &amp;quot;Master Recipe&amp;quot; and should serve as an experience harvesting tool. &lt;br /&gt;
&lt;br /&gt;
*It has a rather broad coverage to facilitate long-tewrm growth and development. Aditional compact aggregator pages may be needed to pesent specific information concisely. &lt;br /&gt;
*There would be separate webs within the wiki: Public(or Main), NESG, and member lab webs. Most common knowlege topics should be public, unless they are specific to NESG &lt;br /&gt;
*We assume that the target audience has some knowledge about NMR and protein structure determination, but make the content useful for training &lt;br /&gt;
*&amp;quot;Resonance Assignment&amp;quot; and &amp;quot;Structure Determination&amp;quot; chaptes would focus on individual software packages. The XEASY resonance assignment tree, as the most complete, would serve as a template for other software. &lt;br /&gt;
*Most chapters should include a &amp;quot;general principles&amp;quot; section.&lt;br /&gt;
&lt;br /&gt;
Please leave your comments/suggestion at the bottom of this page &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
= HTP NMR structure determination  =&lt;br /&gt;
&lt;br /&gt;
== Protein Target Selection, Sample Preparation, and Initial Screening  ==&lt;br /&gt;
&lt;br /&gt;
#[[Target selection|NESG target selection]] - overview of target selection in PSI III &lt;br /&gt;
#[[Bioinformatics with protein sequence]] &lt;br /&gt;
#[[DNA cloning protocols|DNA cloning protocols]]&amp;lt;br&amp;gt; &lt;br /&gt;
#[[Protein purification|Protein expression and purification protocols]]&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
#Sample Optimization &lt;br /&gt;
##[[construct optimization]]&lt;br /&gt;
##[[Buffer optimization]] &lt;br /&gt;
##[[Cofactor optimization]] &lt;br /&gt;
#Initial protein analysis &lt;br /&gt;
##[[SDS page gel]] &lt;br /&gt;
##[[Protein concentration|Protein concentration measurements]] &lt;br /&gt;
##[[Oligomerization Status|Assessment of Oligomerization Status]] &lt;br /&gt;
###[[Gel filtration and light scattering|gel-filtration and light scattering]] &lt;br /&gt;
###[[Sedimentation equilibrium|Sedimentation equilibrium]] &lt;br /&gt;
###[[NMR determined Rotational correlation time]] &lt;br /&gt;
##[[MassSpectrometry|Mass spectrum]] &lt;br /&gt;
##NMR screening &lt;br /&gt;
###[[1D screening|&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H 1D screening]] &lt;br /&gt;
###[[Nhsqc screen|Initial [&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H] HSQC]]&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== NMR Data Collection  ==&lt;br /&gt;
&lt;br /&gt;
#Routine operation &lt;br /&gt;
##[[NMR sample tubes]] &lt;br /&gt;
##[[NMR Sample Preparation]] &lt;br /&gt;
##[[Inserting NMR Sample]] &lt;br /&gt;
##Tuning and matching &lt;br /&gt;
##[[Deuterium Lock]] &lt;br /&gt;
##[[Shimming]] &lt;br /&gt;
##[[Pulse width calibration]] &lt;br /&gt;
##[[Temperature calibration]] &lt;br /&gt;
##[[Chemical shift referencing]] &lt;br /&gt;
#Advanced operation &lt;br /&gt;
##[[Deuterium pulse width calibration and decoupling]] &lt;br /&gt;
#NMR data acquisition for protein structure determination &lt;br /&gt;
##[[Common NMR experiment sets]] &lt;br /&gt;
##Custom NMR experiment setup scripts for VNMRJ &lt;br /&gt;
##1D 1H NMR spectra and 2D [15N, 1H]-HSQC &lt;br /&gt;
##[[Estimation of rotational correlation time]]&lt;br /&gt;
##Estimation of measurement time &lt;br /&gt;
##NMR experiments for spin system identification &lt;br /&gt;
##2D and 3D NOESY &lt;br /&gt;
##Double and triple NMR experiments &lt;br /&gt;
###3D CBCA(CO)NH and HNCACB &lt;br /&gt;
###3D HNCA and HN(CO)CA &lt;br /&gt;
###3D HAHB(CO)NH &lt;br /&gt;
###(4,3)D CABCA(CO)NH and HNCACB &lt;br /&gt;
###(4,3)D HABCAB(CO)NH &lt;br /&gt;
###(H)CCH &lt;br /&gt;
###(H)CCH-TOCSY &lt;br /&gt;
###H(C)CH &lt;br /&gt;
###H(C)CH-TOCSY &lt;br /&gt;
###(4,3)D HCCH &lt;br /&gt;
##Other NMR experiments &lt;br /&gt;
###2D [13C, 1H]-HSQC for 5% 13C-labeled samples &lt;br /&gt;
###2D [15N, 1H]-long-range-HSQC for determination of histidine protomer state &lt;br /&gt;
###MEXICO &lt;br /&gt;
###CLEANEX &lt;br /&gt;
###H-D exchange experiment &lt;br /&gt;
###15N spin relaxation parameters &lt;br /&gt;
#Advanced problems for data collection &lt;br /&gt;
##Setting up non-uniformly sampled spectra &lt;br /&gt;
###Guide for Varian/BioPack &lt;br /&gt;
###Guide for Bruker according to Arrowsmith group &lt;br /&gt;
#Maintenance &lt;br /&gt;
##VARIAN &lt;br /&gt;
###Installing and updating &amp;lt;span class=&amp;quot;twikiNewLink&amp;quot;&amp;gt;BioPack&amp;lt;/span&amp;gt; &lt;br /&gt;
###Full Probefile calibration &lt;br /&gt;
###Rebooting the console &lt;br /&gt;
###Cryoprobe conditioning &lt;br /&gt;
##BRUKER&lt;br /&gt;
&lt;br /&gt;
== NMR Data Processing  ==&lt;br /&gt;
&lt;br /&gt;
#General Priciples and Concepts &lt;br /&gt;
##Fourier transformation &lt;br /&gt;
###Zero-filling &lt;br /&gt;
###Apodization &lt;br /&gt;
###Phasing &lt;br /&gt;
###Linear prediction &lt;br /&gt;
###G-matrix Fourier transformation (GFT) &lt;br /&gt;
##Alternatives to Fourier transformation &lt;br /&gt;
###Maximum entropy reconstruction &lt;br /&gt;
###MDD reconstruction &lt;br /&gt;
###... &lt;br /&gt;
#Practical Aspects &lt;br /&gt;
##NMRPIPE &lt;br /&gt;
###&amp;lt;font color=&amp;quot;#000000&amp;quot;&amp;gt;General information&amp;lt;/font&amp;gt; &lt;br /&gt;
###&amp;lt;font color=&amp;quot;#0000ff&amp;quot;&amp;gt;Buffalo's Processing Protocol using NMRpipe&amp;lt;/font&amp;gt; &lt;br /&gt;
##PROSA &lt;br /&gt;
##TOPSPIN &lt;br /&gt;
##[[AGNuS/AutoProc|AGNuS/AutoProc]] &lt;br /&gt;
##UBNMR &lt;br /&gt;
##Spectral format conversion&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== Resonance Assignment  ==&lt;br /&gt;
&lt;br /&gt;
This chapter would focus on individual data analysis and resonance assignment packages, as most people stick to a particular software for entire structure determination projects. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
#[[Principles and concepts]] &lt;br /&gt;
##[[Stable isotope labeling schemes]] &lt;br /&gt;
##[[NMR experiments]] &lt;br /&gt;
###[[Through-bond]] &lt;br /&gt;
###[[Through space]] &lt;br /&gt;
##[[Spin systems]] &lt;br /&gt;
###[[Definitions]] &lt;br /&gt;
###[[Identification]] &lt;br /&gt;
###[[Linking spin systems]] &lt;br /&gt;
###[[Matching onto covalent structure]] &lt;br /&gt;
#[[Practical aspects]] &lt;br /&gt;
##[[Semi-automated protocols]] &lt;br /&gt;
###[[CARA]] &lt;br /&gt;
####[[Spin System Identification with CARA|Spin System Identification in 2D 15N-HSQC and 3D HNNCO]] &lt;br /&gt;
####[[Backbone Assignment with CARA|Backbone Resonance Assignment]] &lt;br /&gt;
####[[HA and HB Assignment with CARA|Assignment of HA and HB Resonances with (4,3)D GFT HABCAB(CO)NHN]] &lt;br /&gt;
####Side Chain Assignment &lt;br /&gt;
#####[[Aliphatic Side Chain Assignment with CARA|Aliphatic side-chain assignment]] &lt;br /&gt;
#####[[Aromatic Side Chain Assignment with CARA|Aromatic side-chain assignment]] &lt;br /&gt;
#####[[Amide Side Chain Assignment with CARA|Amide side-chain assignment]] &lt;br /&gt;
###[[Sparky]] &lt;br /&gt;
###[[XEASY]] &lt;br /&gt;
####[[XEASY Spin system identification|Spin system identification]] &lt;br /&gt;
####[[XEASY Backbone Assignment|Backbone resonance assignment]]'''&amp;lt;br&amp;gt;''' &lt;br /&gt;
#####GFT-based spectra &lt;br /&gt;
######[[HNCACAB/CABCA(CO)NH]] &lt;br /&gt;
#####Conventional spectra &lt;br /&gt;
######[[HNCACB/CBCA(CO)NH]] &lt;br /&gt;
######HNCA/HN(CO)CA &lt;br /&gt;
######HNCO/HN(CA)CO &lt;br /&gt;
######NOESY/TOCSY &lt;br /&gt;
####[[XEASY Side Chain Assignment|Side chain resonance assignment]] &lt;br /&gt;
#####Aliphatic &lt;br /&gt;
######GFT NMR spectra &lt;br /&gt;
#######[[HA and HB Assignment with GFT in XEASY|(4,3)D GFT HABCAB(CO)NHN]] &lt;br /&gt;
#######[[Side chain assignment with aliphatic (4,3)D HCCH-COSY in XEASY|(4,3)D GFT HCCH]] &lt;br /&gt;
######Conventional spectra &lt;br /&gt;
#######HAHB(CO)NH &lt;br /&gt;
#######HCCH-COSY &lt;br /&gt;
#######HCCH-TOCSY &lt;br /&gt;
#######[[Side chain assignment with CN-NOESY in XEASY|Simultaneous NOESY]] &lt;br /&gt;
#######(H)CC-TOCSY-(CO)NH &lt;br /&gt;
#######H(CC-TOCSY-CO)NH &lt;br /&gt;
#####[[Aromatic side chain assignment with Aro-HCCH-COSY in XEASY|Aromatic]] &lt;br /&gt;
######GFT-based spectra &lt;br /&gt;
######Conventional spectra &lt;br /&gt;
#####Other &lt;br /&gt;
######Trp e1 NH and d1 CH &lt;br /&gt;
######[[Met methyl assignment with NOESY|Met e CH3 ]] &lt;br /&gt;
######[[Amide Side Chain assignment with NOESY|Asn d2 and Gln e2 NH2]] &lt;br /&gt;
#####NOESY peak integration &lt;br /&gt;
##Automated protocols &lt;br /&gt;
###[[AutoAssign|AutoAssign]] &lt;br /&gt;
###[[AutoAssign WebServer|AutoAssign server]] &lt;br /&gt;
###[[Abacus|ABACUS]] &lt;br /&gt;
###[[The PINE Server|PINE server]] &lt;br /&gt;
##Validation of resonance assignment &lt;br /&gt;
###[[AVS|AVSx]] &lt;br /&gt;
###[[LACS|LACSx]] &lt;br /&gt;
##Depositing chemical shifts&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== Structure Calculation and Validation  ==&lt;br /&gt;
&lt;br /&gt;
#[[Structure Calculation and Validation|Principles and concepts]] &lt;br /&gt;
#Practical aspects &lt;br /&gt;
##Structure calculation &lt;br /&gt;
###CYANA &lt;br /&gt;
####[[CYANA|Getting started]] &lt;br /&gt;
####[[FOUND|FOUND]] &lt;br /&gt;
####[[TALOS|TALOS]] &lt;br /&gt;
####[[GLOMSA|GLOMSA]] &lt;br /&gt;
####[[NOE Calibration Using CYANA|NOE calibration]] &lt;br /&gt;
####[[Manual Structure Calculation Using CYANA|Manual structure calculation]] &lt;br /&gt;
####[[Automated NOESY Assignment Using CYANA|Automated NOESY assignment and structure calculation]] &lt;br /&gt;
####[[Structure Calculation With RDC's Using CYANA|Structure calculation with residual dipolar couplings]] (link to REDCAT/PALES,FINDTENSOR, .rdc file, adding ORI to PDB file) &lt;br /&gt;
####[[Homodimer Structure Calculation Using CYANA|Homodimer structure calculations]][[Homodimer Structure Calculation Using CYANA|&amp;lt;br&amp;gt;]] &lt;br /&gt;
###AutoStructure &lt;br /&gt;
####[[AutoStructure/RPF Theory|Theory]] &lt;br /&gt;
####[[AutoStructure|Getting started]] &lt;br /&gt;
####[[CYANA Structure Calculations Using AutoStructure|CYANA run]] &lt;br /&gt;
####[[XPLOR Structure Calculations Using AutoStructure|XPLOR run]] &lt;br /&gt;
####[[Analyzing AutoStructure Output Directories|Analyzing the output]] &lt;br /&gt;
####[[RPF Analysis|RPF/DP scores]] &lt;br /&gt;
####[[Structure Calculation Using AS-DP|Structure calculation using AS-DP]] &lt;br /&gt;
###&amp;quot;Consensus&amp;quot;&amp;amp;nbsp;Approaches &lt;br /&gt;
####[[Overview of Consensus Runs|Overview of Consensus runs]] &lt;br /&gt;
####[[Finding Consensus NOE Assignments|Finding Consensus NOE assignments]] &lt;br /&gt;
####[[Validation of Consensus Run|Validation of Consensus runs]] &lt;br /&gt;
###[[Structure Calculation Using CS-Rosetta|CS-ROSETTA]] &lt;br /&gt;
###[[Structure Calculation Using CS-CP ROSETTA|CS-DP ROSETTA]] &lt;br /&gt;
###[[Structure Calculation Using RDC-ROSETTA|RDC-ROSETTA]] &lt;br /&gt;
###[[RDC-Assisted Dimer Structure Determination|RDC-assisted dimer structure calculation]]&amp;lt;br&amp;gt; &lt;br /&gt;
###Special topics &lt;br /&gt;
####[[Protein-Ligand Complexes|Protein-Ligand complexes]] &lt;br /&gt;
####[[Working With Metal Ions|Metal ions]] &lt;br /&gt;
####[[Working With Dimers|Dimers]] &lt;br /&gt;
####[[Residual Dipolar Couplings in Structure Refinement|Residual Dipolar Couplings]] &lt;br /&gt;
####[[REDCAT|REDCAT]]&amp;amp;nbsp;and [[REDCRAFT|REDCRAFT]] &lt;br /&gt;
####[[Paramagnetic Constraints in Structure Determination|Paramagnetic constraints]] &lt;br /&gt;
##Structure Refinement &lt;br /&gt;
###[[Structure Refinement Using CNS Energy Minimization With Explicit Water|CNS refinement]] &lt;br /&gt;
###[[Structure Refinement Using XPLOR-NIH|XPLOR-NIH refinement]] &lt;br /&gt;
###[[Rosetta High Resolution Protein Structure Refinement Protocol|ROSETTA refinement]] &lt;br /&gt;
##Validation and deposition &lt;br /&gt;
###[[PdbStat|PdbStat]] &lt;br /&gt;
###[[PSVS|PSVS]] &lt;br /&gt;
###[[RPF Analysis|RPF analysis]] &lt;br /&gt;
###[[MolProbity Server|MolProbity server]] &lt;br /&gt;
###[[PDB and BMRB Deposition|PDB and BMRB deposition]] &lt;br /&gt;
###[[ADIT-NMR|ADIT-NMR]] &lt;br /&gt;
###[[HarvestDB|HarvestDB]] &lt;br /&gt;
###[[SPINS|SPINS]]&lt;br /&gt;
&lt;br /&gt;
-- JeffMills - 28 May 2009 &lt;br /&gt;
&lt;br /&gt;
Here are two comments from Guy: &lt;br /&gt;
&lt;br /&gt;
- need to have centralized site for downloading all software that NESG has developed or licensed; this would be a central site for NESG scientists to use to access the latest version of all software &lt;br /&gt;
&lt;br /&gt;
- need to allow outside users to access links to all software (they will need licenses to download) and also to download software from NESG &lt;br /&gt;
&lt;br /&gt;
-- AlexEletski - 13 Jul 2009 &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Wiki_Tree_Layout&amp;diff=2038</id>
		<title>Wiki Tree Layout</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Wiki_Tree_Layout&amp;diff=2038"/>
		<updated>2009-11-20T15:35:16Z</updated>

		<summary type="html">&lt;p&gt;Prossi: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;This outline of the NESG NMR Wiki is designed to expand on the existing &amp;quot;Master Recipe&amp;quot; and should serve as an experience harvesting tool. &lt;br /&gt;
&lt;br /&gt;
*It has a rather broad coverage to facilitate long-tewrm growth and development. Aditional compact aggregator pages may be needed to pesent specific information concisely. &lt;br /&gt;
*There would be separate webs within the wiki: Public(or Main), NESG, and member lab webs. Most common knowlege topics should be public, unless they are specific to NESG &lt;br /&gt;
*We assume that the target audience has some knowledge about NMR and protein structure determination, but make the content useful for training &lt;br /&gt;
*&amp;quot;Resonance Assignment&amp;quot; and &amp;quot;Structure Determination&amp;quot; chaptes would focus on individual software packages. The XEASY resonance assignment tree, as the most complete, would serve as a template for other software. &lt;br /&gt;
*Most chapters should include a &amp;quot;general principles&amp;quot; section.&lt;br /&gt;
&lt;br /&gt;
Please leave your comments/suggestion at the bottom of this page &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
= HTP NMR structure determination  =&lt;br /&gt;
&lt;br /&gt;
== Protein Target Selection, Sample Preparation, and Initial Screening  ==&lt;br /&gt;
&lt;br /&gt;
#[[Target selection|NESG target selection]] - overview of target selection in PSI III &lt;br /&gt;
#[[Bioinformatics with protein sequence]] &lt;br /&gt;
#[[DNA cloning protocols|DNA cloning protocols]]&amp;lt;br&amp;gt; &lt;br /&gt;
#[[Protein purification|Protein expression and purification protocols]]&amp;amp;nbsp;&amp;lt;br&amp;gt; &lt;br /&gt;
#Sample Optimization &lt;br /&gt;
##[[construct optimization]]&lt;br /&gt;
##[[Buffer optimization]] &lt;br /&gt;
##[[Cofactor optimization]] &lt;br /&gt;
#Initial protein analysis &lt;br /&gt;
##[[SDS page gel]] &lt;br /&gt;
##[[Protein concentration|Protein concentration measurements]] &lt;br /&gt;
##[[Oligomerization Status|Assessment of Oligomerization Status]] &lt;br /&gt;
###[[Gel filtration and light scattering|gel-filtration and light scattering]] &lt;br /&gt;
###[[Sedimentation equilibrium|Sedimentation equilibrium]] &lt;br /&gt;
###[[NMR determined Rotational correlation time]] &lt;br /&gt;
##[[MassSpectrometry|Mass spectrum]] &lt;br /&gt;
##NMR screening &lt;br /&gt;
###[[1D screening|&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H 1D screening]] &lt;br /&gt;
###[[Nhsqc screen|Initial [&amp;lt;sup&amp;gt;15&amp;lt;/sup&amp;gt;N,&amp;lt;sup&amp;gt;1&amp;lt;/sup&amp;gt;H] HSQC]]&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== NMR Data Collection  ==&lt;br /&gt;
&lt;br /&gt;
#Routine operation &lt;br /&gt;
##[[NMR sample tubes]] &lt;br /&gt;
##[[NMR Sample Preparation]] &lt;br /&gt;
##[[Inserting NMR Sample]] &lt;br /&gt;
##Tuning and matching &lt;br /&gt;
##[[Deuterium Lock]] &lt;br /&gt;
##[[Shimming]] &lt;br /&gt;
##[[Pulse width calibration]] &lt;br /&gt;
##[[Temperature calibration]] &lt;br /&gt;
##[[Chemical shift referencing]] &lt;br /&gt;
#Advanced operation &lt;br /&gt;
##[[Deuterium pulse width calibration and decoupling]] &lt;br /&gt;
#NMR data acquisition for protein structure determination &lt;br /&gt;
##[[Common NMR experiment sets]] &lt;br /&gt;
##Custom NMR experiment setup scripts for VNMRJ &lt;br /&gt;
##1D 1H NMR spectra and 2D [15N, 1H]-HSQC &lt;br /&gt;
##[[Estimation of rotational correlation time]]&lt;br /&gt;
##Estimation of measurement time &lt;br /&gt;
##NMR experiments for spin system identification &lt;br /&gt;
##2D and 3D NOESY &lt;br /&gt;
##Double and triple NMR experiments &lt;br /&gt;
###3D CBCA(CO)NH and HNCACB &lt;br /&gt;
###3D HNCA and HN(CO)CA &lt;br /&gt;
###3D HAHB(CO)NH &lt;br /&gt;
###(4,3)D CABCA(CO)NH and HNCACB &lt;br /&gt;
###(4,3)D HABCAB(CO)NH &lt;br /&gt;
###(H)CCH &lt;br /&gt;
###(H)CCH-TOCSY &lt;br /&gt;
###H(C)CH &lt;br /&gt;
###H(C)CH-TOCSY &lt;br /&gt;
###(4,3)D HCCH &lt;br /&gt;
##Other NMR experiments &lt;br /&gt;
###2D [13C, 1H]-HSQC for 5% 13C-labeled samples &lt;br /&gt;
###2D [15N, 1H]-long-range-HSQC for determination of histidine protomer state &lt;br /&gt;
###MEXICO &lt;br /&gt;
###CLEANEX &lt;br /&gt;
###H-D exchange experiment &lt;br /&gt;
###15N spin relaxation parameters &lt;br /&gt;
#Advanced problems for data collection &lt;br /&gt;
##Setting up non-uniformly sampled spectra &lt;br /&gt;
###Guide for Varian/BioPack &lt;br /&gt;
###Guide for Bruker according to Arrowsmith group &lt;br /&gt;
#Maintenance &lt;br /&gt;
##VARIAN &lt;br /&gt;
###Installing and updating &amp;lt;span class=&amp;quot;twikiNewLink&amp;quot;&amp;gt;BioPack&amp;lt;/span&amp;gt; &lt;br /&gt;
###Full Probefile calibration &lt;br /&gt;
###Rebooting the console &lt;br /&gt;
###Cryoprobe conditioning &lt;br /&gt;
##BRUKER&lt;br /&gt;
&lt;br /&gt;
== NMR Data Processing  ==&lt;br /&gt;
&lt;br /&gt;
#General Priciples and Concepts &lt;br /&gt;
##Fourier transformation &lt;br /&gt;
###Zero-filling &lt;br /&gt;
###Apodization &lt;br /&gt;
###Phasing &lt;br /&gt;
###Linear prediction &lt;br /&gt;
###G-matrix Fourier transformation (GFT) &lt;br /&gt;
##Alternatives to Fourier transformation &lt;br /&gt;
###Maximum entropy reconstruction &lt;br /&gt;
###MDD reconstruction &lt;br /&gt;
###... &lt;br /&gt;
#Practical Aspects &lt;br /&gt;
##NMRPIPE &lt;br /&gt;
###&amp;lt;font color=&amp;quot;#000000&amp;quot;&amp;gt;General information&amp;lt;/font&amp;gt; &lt;br /&gt;
###&amp;lt;font color=&amp;quot;#0000ff&amp;quot;&amp;gt;Buffalo's Processing Protocol using NMRpipe&amp;lt;/font&amp;gt; &lt;br /&gt;
##PROSA &lt;br /&gt;
##TOPSPIN &lt;br /&gt;
##[[AGNuS/AutoProc|AGNuS/AutoProc]] &lt;br /&gt;
##UBNMR &lt;br /&gt;
##Spectral format conversion&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== Resonance Assignment  ==&lt;br /&gt;
&lt;br /&gt;
This chapter would focus on individual data analysis and resonance assignment packages, as most people stick to a particular software for entire structure determination projects. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
#[[Principles and concepts]] &lt;br /&gt;
##[[Stable isotope labeling schemes]] &lt;br /&gt;
##[[NMR experiments]] &lt;br /&gt;
###[[Through-bond]] &lt;br /&gt;
###[[Through space]] &lt;br /&gt;
##[[Spin systems]] &lt;br /&gt;
###[[Definitions]] &lt;br /&gt;
###[[Identification]] &lt;br /&gt;
###[[Linking spin systems]] &lt;br /&gt;
###[[Matching onto covalent structure]] &lt;br /&gt;
#[[Practical aspects]] &lt;br /&gt;
##[[Semi-automated protocols]] &lt;br /&gt;
###[[CARA]] &lt;br /&gt;
####[[Spin System Identification with CARA|Spin System Identification in 2D 15N-HSQC and 3D HNNCO]] &lt;br /&gt;
####[[Backbone Assignment with CARA|Backbone Resonance Assignment]] &lt;br /&gt;
####[[HA and HB Assignment with CARA|Assignment of HA and HB Resonances with (4,3)D GFT HABCAB(CO)NHN]] &lt;br /&gt;
####Side Chain Assignment &lt;br /&gt;
#####[[Aliphatic Side Chain Assignment with CARA|Aliphatic side-chain assignment]] &lt;br /&gt;
#####[[Aromatic Side Chain Assignment with CARA|Aromatic side-chain assignment]] &lt;br /&gt;
#####[[Amide Side Chain Assignment with CARA|Amide side-chain assignment]] &lt;br /&gt;
###[[Sparky]] &lt;br /&gt;
###[[XEASY]] &lt;br /&gt;
####[[XEASY Spin system identification|Spin system identification]] &lt;br /&gt;
####[[XEASY Backbone Assignment|Backbone resonance assignment]]'''&amp;lt;br&amp;gt;''' &lt;br /&gt;
#####GFT-based spectra &lt;br /&gt;
######[[HNCACAB/CABCA(CO)NH]] &lt;br /&gt;
#####Conventional spectra &lt;br /&gt;
######[[HNCACB/CBCA(CO)NH]] &lt;br /&gt;
######HNCA/HN(CO)CA &lt;br /&gt;
######HNCO/HN(CA)CO &lt;br /&gt;
######NOESY/TOCSY &lt;br /&gt;
####[[XEASY Side Chain Assignment|Side chain resonance assignment]] &lt;br /&gt;
#####Aliphatic &lt;br /&gt;
######GFT NMR spectra &lt;br /&gt;
#######[[HA and HB Assignment with GFT in XEASY|(4,3)D GFT HABCAB(CO)NHN]] &lt;br /&gt;
#######[[Side chain assignment with aliphatic (4,3)D HCCH-COSY in XEASY|(4,3)D GFT HCCH]] &lt;br /&gt;
######Conventional spectra &lt;br /&gt;
#######HAHB(CO)NH &lt;br /&gt;
#######HCCH-COSY &lt;br /&gt;
#######HCCH-TOCSY &lt;br /&gt;
#######[[Side chain assignment with CN-NOESY in XEASY|Simultaneous NOESY]] &lt;br /&gt;
#######(H)CC-TOCSY-(CO)NH &lt;br /&gt;
#######H(CC-TOCSY-CO)NH &lt;br /&gt;
#####[[Aromatic side chain assignment with Aro-HCCH-COSY in XEASY|Aromatic]] &lt;br /&gt;
######GFT-based spectra &lt;br /&gt;
######Conventional spectra &lt;br /&gt;
#####Other &lt;br /&gt;
######Trp e1 NH and d1 CH &lt;br /&gt;
######[[Met methyl assignment with NOESY|Met e CH3 ]] &lt;br /&gt;
######[[Amide Side Chain assignment with NOESY|Asn d2 and Gln e2 NH2]] &lt;br /&gt;
#####NOESY peak integration &lt;br /&gt;
##Automated protocols &lt;br /&gt;
###[[AutoAssign|AutoAssign]] &lt;br /&gt;
###[[AutoAssign WebServer|AutoAssign server]] &lt;br /&gt;
###[[Abacus|ABACUS]] &lt;br /&gt;
###[[The PINE Server|PINE server]] &lt;br /&gt;
##Validation of resonance assignment &lt;br /&gt;
###[[AVS|AVS]] &lt;br /&gt;
###[[LACS|LACS]] &lt;br /&gt;
##Depositing chemical shifts&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== Structure Calculation and Validation  ==&lt;br /&gt;
&lt;br /&gt;
#[[Structure Calculation and Validation|Principles and concepts]] &lt;br /&gt;
#Practical aspects &lt;br /&gt;
##Structure calculation &lt;br /&gt;
###CYANA &lt;br /&gt;
####[[CYANA|Getting started]] &lt;br /&gt;
####[[FOUND|FOUND]] &lt;br /&gt;
####[[TALOS|TALOS]] &lt;br /&gt;
####[[GLOMSA|GLOMSA]] &lt;br /&gt;
####[[NOE Calibration Using CYANA|NOE calibration]] &lt;br /&gt;
####[[Manual Structure Calculation Using CYANA|Manual structure calculation]] &lt;br /&gt;
####[[Automated NOESY Assignment Using CYANA|Automated NOESY assignment and structure calculation]] &lt;br /&gt;
####[[Structure Calculation With RDC's Using CYANA|Structure calculation with residual dipolar couplings]] (link to REDCAT/PALES,FINDTENSOR, .rdc file, adding ORI to PDB file) &lt;br /&gt;
####[[Homodimer Structure Calculation Using CYANA|Homodimer structure calculations]][[Homodimer Structure Calculation Using CYANA|&amp;lt;br&amp;gt;]] &lt;br /&gt;
###AutoStructure &lt;br /&gt;
####[[AutoStructure/RPF Theory|Theory]] &lt;br /&gt;
####[[AutoStructure|Getting started]] &lt;br /&gt;
####[[CYANA Structure Calculations Using AutoStructure|CYANA run]] &lt;br /&gt;
####[[XPLOR Structure Calculations Using AutoStructure|XPLOR run]] &lt;br /&gt;
####[[Analyzing AutoStructure Output Directories|Analyzing the output]] &lt;br /&gt;
####[[RPF Analysis|RPF/DP scores]] &lt;br /&gt;
####[[Structure Calculation Using AS-DP|Structure calculation using AS-DP]] &lt;br /&gt;
###&amp;quot;Consensus&amp;quot;&amp;amp;nbsp;Approaches &lt;br /&gt;
####[[Overview of Consensus Runs|Overview of Consensus runs]] &lt;br /&gt;
####[[Finding Consensus NOE Assignments|Finding Consensus NOE assignments]] &lt;br /&gt;
####[[Validation of Consensus Run|Validation of Consensus runs]] &lt;br /&gt;
###[[Structure Calculation Using CS-Rosetta|CS-ROSETTA]] &lt;br /&gt;
###[[Structure Calculation Using CS-CP ROSETTA|CS-DP ROSETTA]] &lt;br /&gt;
###[[Structure Calculation Using RDC-ROSETTA|RDC-ROSETTA]] &lt;br /&gt;
###[[RDC-Assisted Dimer Structure Determination|RDC-assisted dimer structure calculation]]&amp;lt;br&amp;gt; &lt;br /&gt;
###Special topics &lt;br /&gt;
####[[Protein-Ligand Complexes|Protein-Ligand complexes]] &lt;br /&gt;
####[[Working With Metal Ions|Metal ions]] &lt;br /&gt;
####[[Working With Dimers|Dimers]] &lt;br /&gt;
####[[Residual Dipolar Couplings in Structure Refinement|Residual Dipolar Couplings]] &lt;br /&gt;
####[[REDCAT|REDCAT]]&amp;amp;nbsp;and [[REDCRAFT|REDCRAFT]] &lt;br /&gt;
####[[Paramagnetic Constraints in Structure Determination|Paramagnetic constraints]] &lt;br /&gt;
##Structure Refinement &lt;br /&gt;
###[[Structure Refinement Using CNS Energy Minimization With Explicit Water|CNS refinement]] &lt;br /&gt;
###[[Structure Refinement Using XPLOR-NIH|XPLOR-NIH refinement]] &lt;br /&gt;
###[[Rosetta High Resolution Protein Structure Refinement Protocol|ROSETTA refinement]] &lt;br /&gt;
##Validation and deposition &lt;br /&gt;
###[[PdbStat|PdbStat]] &lt;br /&gt;
###[[PSVS|PSVS]] &lt;br /&gt;
###[[RPF Analysis|RPF analysis]] &lt;br /&gt;
###[[MolProbity Server|MolProbity server]] &lt;br /&gt;
###[[PDB and BMRB Deposition|PDB and BMRB deposition]] &lt;br /&gt;
###[[ADIT-NMR|ADIT-NMR]] &lt;br /&gt;
###[[HarvestDB|HarvestDB]] &lt;br /&gt;
###[[SPINS|SPINS]]&lt;br /&gt;
&lt;br /&gt;
-- JeffMills - 28 May 2009 &lt;br /&gt;
&lt;br /&gt;
Here are two comments from Guy: &lt;br /&gt;
&lt;br /&gt;
- need to have centralized site for downloading all software that NESG has developed or licensed; this would be a central site for NESG scientists to use to access the latest version of all software &lt;br /&gt;
&lt;br /&gt;
- need to allow outside users to access links to all software (they will need licenses to download) and also to download software from NESG &lt;br /&gt;
&lt;br /&gt;
-- AlexEletski - 13 Jul 2009 &lt;br /&gt;
&lt;br /&gt;
&amp;amp;nbsp;&lt;/div&gt;</summary>
		<author><name>Prossi</name></author>
	</entry>
</feed>