
<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
	<id>https://nesgwiki.chem.buffalo.edu/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Xianzhon</id>
	<title>NESG Wiki - User contributions [en]</title>
	<link rel="self" type="application/atom+xml" href="https://nesgwiki.chem.buffalo.edu/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Xianzhon"/>
	<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php/Special:Contributions/Xianzhon"/>
	<updated>2026-04-19T12:52:26Z</updated>
	<subtitle>User contributions</subtitle>
	<generator>MediaWiki 1.38.2</generator>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Mass_Spectrometry&amp;diff=4325</id>
		<title>Mass Spectrometry</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Mass_Spectrometry&amp;diff=4325"/>
		<updated>2015-10-01T18:29:01Z</updated>

		<summary type="html">&lt;p&gt;Xianzhon: /* N-terminal Methionine Cleavage */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== '''Compare Mass Spectrometry m/z with Calculated Protein Mass'''  ==&lt;br /&gt;
&lt;br /&gt;
=== Mass Spectrometry Results from Rutger's University&amp;lt;br&amp;gt;  ===&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
At Rutgers University, spectra are collected on a MALDI-TOF/TOF ([http://cabm-ms.cabm.rutgers.edu/instruments.html ABI-MDS SCIEX 4800]) in single TOF mode.&amp;amp;nbsp; Samples are prepared by mixing 1 ul of the final protein NMR sample with 10 ul of sinapinic acid (SA) matrix solution&amp;lt;!--StartFragment--&amp;gt; &amp;lt;font face=&amp;quot;Verdana, Helvetica, Arial&amp;quot;&amp;gt;&amp;lt;span style=&amp;quot;font-size: 12px;&amp;quot;&amp;gt;(10 mg/ml SA in 50% ACN/50% 0.1% TFA).&amp;lt;/span&amp;gt;&amp;lt;/font&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;font face=&amp;quot;Verdana, Helvetica, Arial&amp;quot;&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/font&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Results: &lt;br /&gt;
&lt;br /&gt;
*The peaks should correspond to your full-length protein mass. &lt;br /&gt;
*The red information across the top is the base peak, BP (the peak with the greatest intensity), followed by the intensity &lt;br /&gt;
*The other peaks are typically m/z (mass-to-charge ratio) with z = 2+, 1/2+, 1/3+, etc. &amp;lt;!--EndFragment--&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;At Rutger's mass spectrometry data is collected for each NC5 sample, NC sample,and unlabelled sample. Error bars for this measurement are typically &amp;amp;lt; 25 Da, but can be more. &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;Some reasons that the MS mass may not match your calculated mass are: &lt;br /&gt;
&lt;br /&gt;
#The MS results might have large error because of instrument or calibration problems (unlikely). &lt;br /&gt;
#The sequence in the database is incorrect. &lt;br /&gt;
#There are mutations in your protein (very common). &lt;br /&gt;
#The protein has covalent modifications. &lt;br /&gt;
#Protein degradation occurs. &lt;br /&gt;
#The N-terminal methionine is cleaved in the ''E.coli'' due to N-terminal methione excision (NME) by methione aminopeptidases (MAPs).&lt;br /&gt;
&lt;br /&gt;
=== Example Mass Spectrum of TaR80B  ===&lt;br /&gt;
&lt;br /&gt;
[http://spine.nesg.org/batch.cgi?id=TaR80B-21.2-NCa-GF http://spine.nesg.org/batch.cgi?id=TaR80B-21.2-NCa-GF] (password protected) &lt;br /&gt;
&lt;br /&gt;
[[Image:MS TaR80Bjpg.jpeg]] &lt;br /&gt;
&lt;br /&gt;
=== N-terminal Methionine Cleavage  ===&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;The propensity for cleavage has been analyzed in a 2006 bioinformatics paper by Frottin ''et al.'':&amp;lt;ref&amp;gt;[http://www.ncbi.nlm.nih.gov/pubmed/16963780?dopt=Abstract F. Frottin, A. Martinez, P. Peynott, M. Sanghamitra, R. C. Holz, C. Giglione, T. Meinnel, Mol Cell Proteomics, 2006, 5, 2336-49]&amp;lt;/ref&amp;gt; &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;In summary, N-Met cleavage is: &lt;br /&gt;
&lt;br /&gt;
*Very likely if the second residue is: A, C, G, P or S &lt;br /&gt;
*Not likely if the second residue is V or T. &lt;br /&gt;
*There are other more complicated influences from the 3rd and 4th residue. &lt;br /&gt;
*Overexpressed proteins are less likely to be cleaved than less highly expressed proteins.&lt;br /&gt;
&lt;br /&gt;
They developed a bioinformatics tool for prediction called [http://www.isv.cnrs-gif.fr/terminator3/index.html '''TermiNator'''] (also available through [http://ca.expasy.org/ ExPASY]):&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Use these Terminator options for proteins overexpressed in E.coli: &lt;br /&gt;
&lt;br /&gt;
*expressed in: Prokaryote (Eubacteria or Archea) &lt;br /&gt;
*Eubacteria &lt;br /&gt;
*Recombinant, plasmid-encoded, overexpressed gene &lt;br /&gt;
*LPR cleavage (leader peptide cleavage) – No &lt;br /&gt;
*Paste your sequence&lt;br /&gt;
&lt;br /&gt;
=== Calculate the expected molecular weight for the NC5 and NC sample  ===&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
[http://www.scripps.edu/~cdputnam/protcalc.html Protein Calculator] is a nice tool that allows to calculate molecular mass of isotopically labeled proteins &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;Another way to calculate the molecular weight for a protein is using the [http://ca.expasy.org/tools/protparam.html ExPASY ProtParam] tool. Just paste your sequence into the web form. The atomic composition at the bottom of the results can be used to correct for the isotopic enrichment as in the examples below.&lt;br /&gt;
&lt;br /&gt;
=== Examples  ===&lt;br /&gt;
&lt;br /&gt;
==== FR629A example (no N-met cleavage)  ====&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;MGHHHHHHSHGKSDFIKVNVSNSHNDAVAFEVKLAKDLTVAQLKTKLEILTGGCAGTMKVQVFKGDTCVSTMDNNDAQLGYYANSDGLRLHVVDS&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;FR629A has the following ProtParam results:&amp;lt;br&amp;gt; Molecular weight: 10343 &lt;br /&gt;
&lt;br /&gt;
Atomic composition:&amp;lt;br&amp;gt; Carbon C 447&amp;lt;br&amp;gt; Nitrogen N 133 &lt;br /&gt;
&lt;br /&gt;
So, the calculated MWs are:&amp;lt;br&amp;gt; Unlabeled: 10343 Da&amp;lt;br&amp;gt; NC5: 10343 + (133 Da for 15N) + (0.05 x 447 Da for 13C) = 10500 Da&amp;lt;br&amp;gt; NC: 10343 + (133 Da for 15N) + (447 Da for 13C) = 10923 Da&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;From Spine, the MS results are:&amp;lt;br&amp;gt; NC5a: 10488 Da (-11 Da from expected)&amp;lt;br&amp;gt; NC5c: 10497 Da (-3 Da from expected)&amp;lt;br&amp;gt; NCa: 10915 Da (+ 8 Da from expected)&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a good match. Terminator3 does not predict N-terminal Met cleavage, even though the second residue, Gly, makes it possible. &lt;br /&gt;
&lt;br /&gt;
==== MbR242E example (with N-Met cleavage)  ====&lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt;MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIATATGMNLTTASANLQALKSGGLVEARREGTRQYYRIAGEDVARLFALVQVVADEHLEHHHHHH&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;MbR242E has the following ProtParam results: &lt;br /&gt;
&lt;br /&gt;
Molecular weight: 11726 &lt;br /&gt;
&lt;br /&gt;
Atomic composition:&amp;lt;br&amp;gt; Carbon C 505&amp;lt;br&amp;gt; Nitrogen N 165 &lt;br /&gt;
&lt;br /&gt;
So, the calculated MWs are:&amp;lt;br&amp;gt; Unlabeled: 11726 Da&amp;lt;br&amp;gt; NC5: 11726 + (165 Da for 15N) + (0.05 x 505 Da for 13C) = 11916 Da &amp;lt;br&amp;gt; NC: 11726 + (165 Da for 15N) + (505 Da for 13C) = 12396 Da&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;From Spine, the MS results are:&amp;lt;br&amp;gt; LBa: 11592 Da (-134 Da from expected)&amp;lt;br&amp;gt; NC5a: 11779 Da (-137 Da from expected)&amp;lt;br&amp;gt; NC5c: 11775 Da (-141 Da from expected)&amp;lt;br&amp;gt; NCa: 12247 Da (-149 Da from expected)&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Since unlabelled Met is 131 Da (and for NC5 is 134, and NC is 137 Da), it seems likely that the N-terminal Met is cleaved.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Note. Terminator3 does not predict N-terminal Met cleavage, even though the second residue, Ala, makes it possible. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=== References  ===&lt;br /&gt;
&lt;br /&gt;
&amp;lt;references /&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xianzhon</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=HydrogenBonds&amp;diff=4243</id>
		<title>HydrogenBonds</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=HydrogenBonds&amp;diff=4243"/>
		<updated>2013-02-13T16:48:35Z</updated>

		<summary type="html">&lt;p&gt;Xianzhon: /*  Hydrogen Bond Constraints for Cyana   */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== &amp;lt;span class=&amp;quot;mw-headline&amp;quot;&amp;gt; '''Usage of Hydrogen Bond Constraints'''  &amp;lt;/span&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
Application of hydrogen bond constraints is optional, though not recommended in the absence of experimental evidence, such as detection of scalar couplings across hydrogen bonds, or measurement of amide proton exchange rates.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
In the absence of direct experimental evidence hydrogen bonds can be inferred from the preliminary structures (for example, if found in &amp;amp;gt;50% of structures in the ensemble). The corresponding hydroden bond constraints can then be used to generate more consistent structure ensembles. Keep in mind that this procedure carries a risk of introducing bias in the resulting structrures. &lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span class=&amp;quot;mw-headline&amp;quot;&amp;gt; '''Hydrogen Bond Constraints for Cyana'''  &amp;lt;/span&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
Each hydrogen bond is defined by a pair of upper and lower distance constraints. This is an example hbond.upl for hydrogen bond upper bounds: &lt;br /&gt;
&amp;lt;pre&amp;gt;13 VAL  H      59 VAL  O       2.00&lt;br /&gt;
13 VAL  N      59 VAL  O       3.00&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
This is an example hbond.lol for lower bound restraints: &lt;br /&gt;
&amp;lt;pre&amp;gt;13 VAL  H      59 VAL  O       1.80&lt;br /&gt;
13 VAL  N      59 VAL  O       2.70&lt;br /&gt;
&amp;lt;/pre&amp;gt; &lt;br /&gt;
Both upper and lower distance constraints can be generated with the &amp;lt;tt&amp;gt;'Hbonds'&amp;lt;/tt&amp;gt; command in CYANA. See also the Hbonds.cya macro in the &amp;lt;tt&amp;gt;demo/tasks&amp;lt;/tt&amp;gt; folder of the CYANA installaion directory. &lt;br /&gt;
&lt;br /&gt;
The default bounds in CYANA are 1.8-2.0 and 2.7-3.0 A. Other values can be chosen for compatibility with alternative software, such as CNS and Xplor.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== &amp;lt;span class=&amp;quot;mw-headline&amp;quot;&amp;gt; '''Hydrogen Bonds Report'''&amp;lt;/span&amp;gt;  ==&lt;br /&gt;
&lt;br /&gt;
A report on hydrogen bonds in the selected structures can be generate with the &amp;lt;tt&amp;gt;'structures hbonds'&amp;lt;/tt&amp;gt; command. Note that the default criteria for considering a particular donor-acceptor pais as hydrogen bonded may be different from the default constraint bounds.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
The same report is also generated by the &amp;lt;tt&amp;gt;overview.cya&amp;lt;/tt&amp;gt; macro at the end of structure calculation. For an example see the [http://www.cyana.org/wiki/index.php/CYANA_Macro:_overview Cyana wiki overview] page.&lt;/div&gt;</summary>
		<author><name>Xianzhon</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Pulse_width_calibration&amp;diff=4183</id>
		<title>Pulse width calibration</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Pulse_width_calibration&amp;diff=4183"/>
		<updated>2012-09-03T03:38:18Z</updated>

		<summary type="html">&lt;p&gt;Xianzhon: /* 13C 90° Pulse Width Calibration */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;br /&gt;
== Calibration of 1H Carrier Frequency (tof)  ==&lt;br /&gt;
&lt;br /&gt;
To achieve the best water suppression &amp;lt;tt&amp;gt;tof&amp;lt;/tt&amp;gt; has to be centered on the H2O resonance. To optimize &amp;lt;tt&amp;gt;tof&amp;lt;/tt&amp;gt;: &lt;br /&gt;
&lt;br /&gt;
#Load a &amp;lt;tt&amp;gt;presat&amp;lt;/tt&amp;gt; or &amp;lt;tt&amp;gt;water&amp;lt;/tt&amp;gt; dataset and set the following parameters:&amp;lt;br&amp;gt; &amp;lt;tt&amp;gt;nt=1 ss=2 satmode='y' ssfilter='n' av&amp;lt;/tt&amp;gt; &lt;br /&gt;
#Acquire a 1D spectrum with &amp;lt;tt&amp;gt;ga&amp;lt;/tt&amp;gt; and expand the region around the H2O signal &lt;br /&gt;
#Array the parameter &amp;lt;tt&amp;gt;satfrq&amp;lt;/tt&amp;gt; around the current value of &amp;lt;tt&amp;gt;tof&amp;lt;/tt&amp;gt;; a range of +/- 10 Hz with a step of 1-2 Hz will suffice &lt;br /&gt;
#Acquire the arrayed spectra. Process and display with &amp;lt;tt&amp;gt;wft dssh dssl&amp;lt;/tt&amp;gt;. The intensity of the water signal should fall, reach a minimum and then rise again. The value of &amp;lt;tt&amp;gt;satfreq&amp;lt;/tt&amp;gt; at the minimum is the correct &amp;lt;tt&amp;gt;tof&amp;lt;/tt&amp;gt; &lt;br /&gt;
#Update the probefile with the new &amp;lt;tt&amp;gt;tof&amp;lt;/tt&amp;gt; value, if necessary&lt;br /&gt;
&lt;br /&gt;
[[Image:Tof1.jpg]] &lt;br /&gt;
&lt;br /&gt;
&amp;lt;br&amp;gt; It is important to use a single increment (&amp;lt;tt&amp;gt;nt=1&amp;lt;/tt&amp;gt;), since phase cycling will likely produce additional water suppression and obscure the optimum &amp;lt;tt&amp;gt;satfreq&amp;lt;/tt&amp;gt;. The solvent subtraction filter should obviously be disabled (&amp;lt;tt&amp;gt;ssfilter='n'&amp;lt;/tt&amp;gt;). Absolute-value mode (&amp;lt;tt&amp;gt;av&amp;lt;/tt&amp;gt;) is better here since you don't have to phase the spectrum. &lt;br /&gt;
&lt;br /&gt;
The water signal profile can be indicative of shimming quality: good shimming will result in a symmetric profile, while bad shimming will lead to an asymmetric profile. &lt;br /&gt;
&lt;br /&gt;
It may be tempting to run a small tip angle 1D and simply take the water peak maximum as the &amp;lt;tt&amp;gt;tof&amp;lt;/tt&amp;gt; value. This method usually yields a different value and worse water suppression than the procedure above.&lt;br /&gt;
&lt;br /&gt;
== Automated Calibration of 90° Pulse Widths ==&lt;br /&gt;
&lt;br /&gt;
The 1H 90° pulse width is very sensitive to the salt content of the sample. Below are two methods for manual calibration. &lt;br /&gt;
&lt;br /&gt;
=== 1H 90° Pulse Width from 1D  ===&lt;br /&gt;
&lt;br /&gt;
To accurately calibrate 1H pw90 with a 1H 1D experiment you have to find the correct 1H pw360 and then take pw90 as pw360/4. Follow these steps: &lt;br /&gt;
&lt;br /&gt;
#Load a &amp;lt;tt&amp;gt;presat&amp;lt;/tt&amp;gt; or &amp;lt;tt&amp;gt;water&amp;lt;/tt&amp;gt; dataset and set the following parameters:&amp;lt;br&amp;gt; &amp;lt;tt&amp;gt;nt=1 ss=2 satmode='y' ssfilter='n' ph&amp;lt;/tt&amp;gt; &lt;br /&gt;
#Acquire a 1D spectrum with &amp;lt;tt&amp;gt;ga&amp;lt;/tt&amp;gt; and phase it to pure absorption. Expand the region of interest (either amide or aliphatic), excluding the water line &lt;br /&gt;
#Array the parameter &amp;lt;tt&amp;gt;pw&amp;lt;/tt&amp;gt; around the expected value of 4*pw90 &lt;br /&gt;
#Acquire the arrayed spectra. Process and display with &amp;lt;tt&amp;gt;wft dssh dssl&amp;lt;/tt&amp;gt;. The intensity should be negative for &amp;lt;tt&amp;gt;pw&amp;lt;/tt&amp;gt; less than pw360, go through zero at pw360 and become positive at &amp;lt;tt&amp;gt;pw&amp;lt;/tt&amp;gt; greater than pw360. &lt;br /&gt;
#Record a spectrum with &amp;lt;tt&amp;gt;pw&amp;lt;/tt&amp;gt; set to pw180. If pw360 is determined correctly the result should be near zero. &lt;br /&gt;
#Update the probefile with the new &amp;lt;tt&amp;gt;pw90&amp;lt;/tt&amp;gt; value, if necessary&lt;br /&gt;
&lt;br /&gt;
Arraying &amp;lt;tt&amp;gt;pw&amp;lt;/tt&amp;gt; directly with the aim of observing maximum signal at pw90 will not yield the true 90° pulse width. Instead it will determine the so-called &amp;quot;Ernst angle&amp;quot;, which depends on the recycle delay &amp;lt;tt&amp;gt;d1&amp;lt;/tt&amp;gt; and the T1 relaxation time of the sample. &lt;br /&gt;
&lt;br /&gt;
However, when working with an unknown sample it is a good idea to use the Ernst angle pulse as an estimate pw90 and then use it to properly set the array range in the pw360 method. &lt;br /&gt;
&lt;br /&gt;
=== 1H 90° Pulse Width from [15N, 1H]- or [13C, 1H]-HSQC  ===&lt;br /&gt;
&lt;br /&gt;
You can also calibrate 1H pw90 with an HSQC dataset (&amp;lt;tt&amp;gt;gNhsqc&amp;lt;/tt&amp;gt;, &amp;lt;tt&amp;gt;gNfhsqc&amp;lt;/tt&amp;gt;, &amp;lt;tt&amp;gt;gChsqc&amp;lt;/tt&amp;gt; or &amp;lt;tt&amp;gt;gCfhsqc&amp;lt;/tt&amp;gt;) &lt;br /&gt;
&lt;br /&gt;
#Load an HSQC dataset. If using &amp;lt;tt&amp;gt;gChsqc&amp;lt;/tt&amp;gt; select the proper type: aliphatic, aromatic, etc. &lt;br /&gt;
#Set &amp;lt;tt&amp;gt;nt=2 ss=4 ni=1 phase=1 calH=1.0&amp;lt;/tt&amp;gt; &lt;br /&gt;
#Acquire the first increment, process it with FT and phase to pure absorption. Expand the region of interest. &lt;br /&gt;
#Array &amp;lt;tt&amp;gt;pw&amp;lt;/tt&amp;gt; from 0 in steps of 1 us &lt;br /&gt;
#Acquire arrayed spectra and process them with &amp;lt;tt&amp;gt;wft dssh dssl&amp;lt;/tt&amp;gt;. The intensity maximum will correspond to pw90. &lt;br /&gt;
#Update the probefile with the new &amp;lt;tt&amp;gt;pw&amp;lt;/tt&amp;gt; value, if necessary&lt;br /&gt;
&lt;br /&gt;
You can also set &amp;lt;tt&amp;gt;calH=2.0&amp;lt;/tt&amp;gt; - in this case the correct pw90 will correspond to zero intensity. &lt;br /&gt;
&lt;br /&gt;
=== 15N and 13C 90° Pulse Width Calibration  ===&lt;br /&gt;
&lt;br /&gt;
#Load a [15N, 1H]-HSQC dataset (&amp;lt;tt&amp;gt;gNhsqc&amp;lt;/tt&amp;gt; or &amp;lt;tt&amp;gt;gNfhsqc&amp;lt;/tt&amp;gt;) &lt;br /&gt;
#Set &amp;lt;tt&amp;gt;nt=2 ss=4 ni=1 phase=1 calN=1.0&amp;lt;/tt&amp;gt; &lt;br /&gt;
#Acquire the first increment, process it with FT and phase to pure absorption. Expand the region of interest. &lt;br /&gt;
#Array &amp;lt;tt&amp;gt;pwN&amp;lt;/tt&amp;gt; from around the expected 90° pulse width &lt;br /&gt;
#Acquire arrayed spectra and process them with &amp;lt;tt&amp;gt;wft dssh dssl&amp;lt;/tt&amp;gt;. The intensity maximum will correspond to the true 90° pulse width. &lt;br /&gt;
#Update the probefile with the new &amp;lt;tt&amp;gt;pwN&amp;lt;/tt&amp;gt; value, if necessary&lt;br /&gt;
&lt;br /&gt;
You can also set &amp;lt;tt&amp;gt;calN=2.0&amp;lt;/tt&amp;gt; - in this case the correct pwN will correspond to zero intensity. &lt;br /&gt;
&lt;br /&gt;
=== 13C 90° Pulse Width Calibration  ===&lt;br /&gt;
&lt;br /&gt;
#Load the &amp;lt;tt&amp;gt;gChsqc&amp;lt;/tt&amp;gt; [13C, 1H]-HSQC dataset&lt;br /&gt;
#Select aromatic carbon type by entring &amp;lt;tt&amp;gt;arom='y' aliph='n' alphaC='n' allC='n' lambda=0.0015&amp;lt;/tt&amp;gt;&lt;br /&gt;
#Set F1 detection mode to ZZ-filter by typing &amp;lt;tt&amp;gt;'ZZ='y' SE='n'&amp;lt;/tt&amp;gt;&lt;br /&gt;
#Set &amp;lt;tt&amp;gt;nt=2 ss=2 ni=1 phase=1 calC=1.0 N15refoc='n'&amp;lt;/tt&amp;gt; &lt;br /&gt;
#Acquire the first increment, process it with FT and phase to pure absorption and expand the aromatic region&lt;br /&gt;
#Set &amp;lt;tt&amp;gt;calC=2.0&amp;lt;/tt&amp;gt; and array &amp;lt;tt&amp;gt;pwC&amp;lt;/tt&amp;gt; around the expected 90° pulse width&lt;br /&gt;
#Acquire arrayed spectra and process them with &amp;lt;tt&amp;gt;wft dssh dssl&amp;lt;/tt&amp;gt; - the zero crossing will correspond to the true 90° 13C pulse width&lt;br /&gt;
#Update the probefile with the new &amp;lt;tt&amp;gt;pwC&amp;lt;/tt&amp;gt; value, if necessary&lt;br /&gt;
&lt;br /&gt;
Focusing on aromatic signals only is the most accurate way to calibrate pwC, since adverse effects due to off-resonance irradiation and non-uniform spin multiplicities are avoided. Along the same lines, ZZ-filter is preferred over gradient-sensitivity enhancement to avoid spurious magnetization transfer, which may obscure the zero crossing point.&lt;br /&gt;
&lt;br /&gt;
If you protein completely lacks aromatic residues, you may use aliphatic signals instead. It is then recommended to shift the carrier from 35 ppm to 25, since it is mostly the methyl signals you will be looking at.&lt;br /&gt;
&lt;br /&gt;
You can use two macros &amp;lt;tt&amp;gt;cof&amp;lt;/tt&amp;gt; and &amp;lt;tt&amp;gt;nof&amp;lt;/tt&amp;gt; to set &amp;lt;tt&amp;gt;dof&amp;lt;/tt&amp;gt; and &amp;lt;tt&amp;gt;dof2&amp;lt;/tt&amp;gt; precisely to a given ppm position. The syntax is like &amp;lt;tt&amp;gt;cof(H1 center in ppm, desired C13 center in ppm)&amp;lt;/tt&amp;gt;. For example, &amp;lt;tt&amp;gt;cof(4.73,35)&amp;lt;/tt&amp;gt; if one wants to set the center of C13 as 35ppm. The same holds true for &amp;lt;tt&amp;gt;nof&amp;lt;/tt&amp;gt;. &amp;lt;tt&amp;gt;cof&amp;lt;/tt&amp;gt; and &amp;lt;tt&amp;gt;nof&amp;lt;/tt&amp;gt; are stored in the &amp;lt;tt&amp;gt;vnmrsys/maclib&amp;lt;/tt&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
You can also keep &amp;lt;tt&amp;gt;calC=1.0&amp;lt;/tt&amp;gt;. In this case the correct pwC will correspond to maximum intensity. This may be the better method for diluted samples, while the zero crossing method is preferred for concentrated ones.&lt;br /&gt;
&lt;br /&gt;
15N and 13C 90° pulse widths are much less sensitive to salt concentration than 1H 90° pulse width. &lt;br /&gt;
&lt;br /&gt;
Longer than usual pulse widths may indicate a poorly tuned and matched channel. &lt;br /&gt;
&lt;br /&gt;
If the calibrated pulse widths are consistently calibrated long for different samples, it indicates a deteriorating probe.&lt;br /&gt;
&lt;br /&gt;
== Automated Calibration of 90° Pulse Widths (BioPack) ==&lt;br /&gt;
&lt;br /&gt;
For every sample you should calibrate 90° pulse widths before acquisition.&lt;br /&gt;
&lt;br /&gt;
Here we assume that you have BioPack installed. BioPack uses a probe file to store all important parameters for its library of biomolecular NMR pulse sequences. Your NMR facility manager should have prepared a fully calibrated probefile. Some parameters in the probefile depend only on the hardware. Other parameters, such as pulse widths, are sample-dependent and have to be calibrated for each sample to achieve maximum signal-to-noise. BioPack also provides tools, which automate the calibration of such parameters and update the probefile.&lt;br /&gt;
&lt;br /&gt;
Depending on you sample's labeling scheme, concentration, etc. you should select from the methods below.&lt;br /&gt;
&lt;br /&gt;
Upon completion of each calibration step related parameters (e.g. decoupling pulse widths, adiabatic pulses) are re-calculated and probefile is automatically updated with new values.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Automated calibration should be verified by analyzing its output. The output is controlled with the parameter &amp;lt;tt&amp;gt;BPplot&amp;lt;/tt&amp;gt;:&lt;br /&gt;
* &amp;lt;tt&amp;gt;BPplot='plot'&amp;lt;/tt&amp;gt; -output is sent to the printer/plotter; make sure you have them both defined.&lt;br /&gt;
* &amp;lt;tt&amp;gt;BPplot='file'&amp;lt;/tt&amp;gt; - output is stored as PGL files in &amp;lt;tt&amp;gt;~/BPplots/&amp;lt;/tt&amp;gt;, these can be viewed with &amp;lt;tt&amp;gt;ggv&amp;lt;/tt&amp;gt; on Linux. (recommended)&lt;br /&gt;
* &amp;lt;tt&amp;gt;BPplot='off'&amp;lt;/tt&amp;gt; - no output. (not recommended)&lt;br /&gt;
&lt;br /&gt;
[[Image:plotting_mode.png|400px|right]]&lt;br /&gt;
You can also use the radio buttons in the '''Setup''' -&amp;gt; '''Calibrations''' tab, under '''Plotting Mode'''.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
In the plotted arrayed spectra check the following:&lt;br /&gt;
* good SN&lt;br /&gt;
* proper spectra without artefacts&lt;br /&gt;
* smooth envelope with a maximum&lt;br /&gt;
* optimal pw90 is correctly determined from the maximum.&lt;br /&gt;
&lt;br /&gt;
=== 1H 90° pulse width only ===&lt;br /&gt;
&lt;br /&gt;
[[Image:1h90only_2.png|400px|right]]&lt;br /&gt;
Use this method if you sample is unlabeled (at natural abundance) or if its concentration is very low.&lt;br /&gt;
&lt;br /&gt;
In VNMRJ window go to the '''Setup''' -&amp;gt; '''Calibrations''' tab and select '''1H pw90 only''' from the pull-down menu.&lt;br /&gt;
&lt;br /&gt;
     &lt;br /&gt;
&lt;br /&gt;
=== 1H and 15N 90° pulse widths ===&lt;br /&gt;
&lt;br /&gt;
[[Image:13cand1honly.png|400px|right]]&lt;br /&gt;
Use this method for 15N- or 15N/13C-labeled samples. '''Do not''' use for natural abundance samples.&lt;br /&gt;
&lt;br /&gt;
In VNMRJ window go to the '''Setup''' -&amp;gt; '''Calibrations''' tab and click on the '''1H and 15N PW90 Only''' button. This method uses the &amp;lt;tt&amp;gt;gNfhsqc&amp;lt;/tt&amp;gt; pulse sequence and looks for the signal maximum.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=== 1H and 13C 90° pulse widths ===&lt;br /&gt;
&lt;br /&gt;
[[Image:usegcfhsqc.png|400px|right]]&lt;br /&gt;
Use this method for 13C- or 15N/13C-labeled samples. '''Do not''' use for 5% 13C-labeled or natural abundance samples.&lt;br /&gt;
&lt;br /&gt;
In VNMRJ window go to the '''Setup''' -&amp;gt; '''Calibrations''' tab and click on the '''1H and 13C PW90 Only''' button. See the picture above.&lt;br /&gt;
&lt;br /&gt;
Depending on the &amp;lt;tt&amp;gt;BPquick&amp;lt;/tt&amp;gt; parameter (see the corresponding checkbox under '''Setup''' -&amp;gt; '''Globals&amp;amp;Probefile''' tab) it will use either &amp;lt;tt&amp;gt;gCfhsqc&amp;lt;/tt&amp;gt; or &amp;lt;tt&amp;gt;hcch_tocsy&amp;lt;/tt&amp;gt; pulse sequence and looks for the signal maximum.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=== 1H, 13C and 15N 90° pulse widths ===&lt;br /&gt;
&lt;br /&gt;
[[Image:rfandgradients.png|400px|right]]&lt;br /&gt;
Use this method for 15N/13C-labeled samples. '''Do not''' use for 5% 13C-labeled or natural abundance samples.&lt;br /&gt;
&lt;br /&gt;
In VNMRJ window go to the '''Setup''' -&amp;gt; '''Calibrations''' tab and select '''RF and Gradients (Fastest)''' from the pull-down menu. This method will use the &amp;lt;tt&amp;gt;ghn_co&amp;lt;/tt&amp;gt; pulse sequence for calibration. It will also calibrate coherence selection gradient amplitudes.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Coherence gradients do not usually change with time and do not depend on the sample. &amp;lt;tt&amp;gt;ghn_co&amp;lt;/tt&amp;gt; is also less sensitive than &amp;lt;tt&amp;gt;gCfhsqc&amp;lt;/tt&amp;gt; and &amp;lt;tt&amp;gt;gNfhsqc&amp;lt;/tt&amp;gt;, and this method takes quite some time to run. It is more convenient to run 1H/13C, and 1H/15N calibrations in succession.&lt;br /&gt;
&lt;br /&gt;
However, this is probably the only method to calibrate 13C 90° pulse width for DCN-labeled samples.&lt;/div&gt;</summary>
		<author><name>Xianzhon</name></author>
	</entry>
	<entry>
		<id>https://nesgwiki.chem.buffalo.edu/index.php?title=Resonance_Assignment/CARA/Aliphatic_side-chain_assignment&amp;diff=4182</id>
		<title>Resonance Assignment/CARA/Aliphatic side-chain assignment</title>
		<link rel="alternate" type="text/html" href="https://nesgwiki.chem.buffalo.edu/index.php?title=Resonance_Assignment/CARA/Aliphatic_side-chain_assignment&amp;diff=4182"/>
		<updated>2012-08-31T14:21:27Z</updated>

		<summary type="html">&lt;p&gt;Xianzhon: /* Filling in the gaps */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Introduction ==&lt;br /&gt;
&lt;br /&gt;
For a short overview of heteronuclear side-chain assignment see this page:&lt;br /&gt;
http://www.cara.ethz.ch/Wiki/HeteronuclearSidechainAssignment&lt;br /&gt;
&lt;br /&gt;
At this point you should have a nearly complete backbone assignment. Most residues should have CA and CB resonances assigned in HNCA, HNCACB, CBCA(CO)NH or CA(CO)NH and HA and HB resonances assigned with HBHA(CO)NH. This topic describes aliphatic side-chain assignment using 3D (H)CCH-COSY, 3D (H)CCH-TOCSY (optional) and 13C-resolved NOESY.&lt;br /&gt;
&lt;br /&gt;
The main steps in aliphatic side-chain assignment are:&lt;br /&gt;
* Validation of HA/CA and HB/CB assignments&lt;br /&gt;
* In some cases, assignment of HA/CA or HB/CB spins (if unassigned previously)&lt;br /&gt;
* Assignment of spins further up the side-chain (HG/CG, HD/CD and HE/CE)&lt;br /&gt;
* Precise positioning of spins in the 13C-resolved NOESY&lt;br /&gt;
&lt;br /&gt;
The recommended procedure is to try to assign one residue at a time as one goes along the protein sequence. One should pick the low-hanging fruits first, though, by looking first at the residues with both HA/CA and HB/CB anchors and considering the rest in the second pass. Also, skip the residues, for which you are not sure how to complete their assignment. The risk of sticking to an incorrect assignment is thus minimized. Once you have a nearly complete assignment, you can even try to locate the missing spins among unassigned spins in 2D [13C, 1H]-HSQC.&lt;br /&gt;
&lt;br /&gt;
There are two approaches to assigning a side chain:&lt;br /&gt;
* '''The standard approach''' is to pick 1H and 13C spins in (H)CCH-COSY or (H)CCH-TOCSY and verify them against 13C-resolved NOESY while progressing up the side chain from CB/HB to CG/HG to CD/HD to CE/HE. (H)CCH-TOCSY also allows to hop over a 13C spin, for example, going from HB/CB to HD/CD, while skipping HG/CG. This approach reduces the risk of incorrect assignments because spins are picked in through-bond correlation experiments.&lt;br /&gt;
* '''The alternative approach''' is to pick spins 1H in 13C- or 15N-resolved NOESY and 13C spins in 13C-resolved NOESY and verify them against (H)CCH-COSY and (H)CCH-TOCSY. This approach carries a much higher risk of incorrect assignments and should in principle be used only if the standard approach fails.&lt;br /&gt;
&lt;br /&gt;
A combination of both approaches can be employed, however, assignment should be done as far as possible with the standard approach.&lt;br /&gt;
&lt;br /&gt;
It is recommended to pick new spins in the &amp;quot;draft&amp;quot; mode first, so that a question mark &amp;quot;?&amp;quot; prefixes the actual spin label. Each spin system may have several spins with identical &amp;quot;draft&amp;quot; labels (e.g. ?CG), though only one final label (CG in this example) is allowed. After you finish the assignment of a side chain, convert &amp;quot;draft&amp;quot; labels to permanent labels by right-clicking on a spin and selecting '''Accept Label'''. Using draft labels helps prevent the propagation of incorrect assignments in cases, when a particular challenging residue is skipped leaving a tentative assignment, which is not fixed at a later stage.&lt;br /&gt;
&lt;br /&gt;
When picking new spins attention should be paid to how the new chemical shift fits the statistical distribution for the corresponding spin type. Checking the '''View -&amp;gt; Show Rulers''' checkbox in SystemScope will display reference lines at average plus and minus four standard deviations in the strip panel. You can also consult the [http://www.bmrb.wisc.edu/ref_info/statsel.htm BMRB online chemical shift statistics page]. If you find a chemical shift that is more than 2 or 3 standard deviations away from average, it doesn't mean ''per se'' that the assignment is incorrect (for example, check out the maximum and minimum columns of the BMRB statistics). However, the probability of this really occurring is very low and, thus, it is a reason to double-check the assignments for this residue.&lt;br /&gt;
&lt;br /&gt;
Also, note that the statistics can be misleading for diastereotopic protons and methyl groups of Val and Leu. Even though HB2 and HB3 of Phe have very close average values, in a real spectrum they can be far apart. The same is true for CG1/2 and HG1/2 of Val, as well as CD1/2 and HD1/2 of Leu.&lt;br /&gt;
&lt;br /&gt;
== Displaying spectra with scopes ==&lt;br /&gt;
&lt;br /&gt;
The complete set for aliphatic side chain assignment has 7 windows open at the same time: &lt;br /&gt;
&lt;br /&gt;
#Open 3D (H)CCH-COSY with '''Open SystemScope (rotated)...'''. In the rotation matrix pop-up window choose the following orientation: '''Hinept''' dimension must be '''Z, Ccosy''' must be '''Y, and Cinept''' must be X. Thus, the left panel of SystemScope will contain a C-C plane (with Ccosy dimension vertical), and the right panel will contain the H-C plane. This issue is addressed in detail in this FAQ question: http://www.cara.ethz.ch/Wiki/FAQ#III10 &lt;br /&gt;
#Open 3D (H)CCH-TOCSY with '''Open SystemScope (rotated)...''' in the same manner as (H)CCH-COSY. Though side-chain assignment can be performed with (H)CCH-COSY, the use of 3D (H)CCH-TOCSY is recommended to improve reliability, especially in case of low signal-to-noise and severe overlap. &lt;br /&gt;
#Open aliphatic 2D [13C, 1H]-HSQC with '''Open PolyScope''' and select aliphatic 13C-resolved NOESY for the strip display. This is similar to displaying 3D HNCO or 3D 15N-resloved NOESY paired with a 2D [15N, 1H]-HSQC. &lt;br /&gt;
#Open 3D 13C-resolved NOESY with '''Open SystemScope'''. Rotation is normally not needed, since the default dimension order is '''Hinept''' = '''X, Hnoe''' = '''Y, Cinept''' = Z. Thus, the left panel of SystemScope will contain an H-H plane (with Hnoe dimension vertical), and the right panel will contain the H-C plane. &lt;br /&gt;
#Open 3D 13C-resolved NOESY with '''Open SystemScope (rotated)...'''. In the rotation matrix pop-up window choose the following orientation: '''Cinept''' = '''X, Hnoe''' = '''Y, and Hinept''' must be Z. &lt;br /&gt;
#Open 3D 15N-resolved NOESY with '''Open StripScope'''. This window will also be used to display triple-resonance spectra. &lt;br /&gt;
#Open 2D [15N, 1H]-HSQC with '''Open PolyScope''' and select 15N-resolved NOESY for the strip display. This window will also be used to display triple-resonance spectra (like HBHA(CO)NH).&lt;br /&gt;
&lt;br /&gt;
It is recommended to disable the default automatic contour level adjustment . In SystemScope windows uncheck '''View-&amp;amp;gt;Auto Contour Level''' and set the appropriate base contour level, '''View-&amp;amp;gt;Set Contour Parameters'''. In PolyScope uncheck '''Plane-&amp;amp;gt;Auto Contour Level''' and '''Strip-&amp;amp;gt;Auto Contour Level''', and use '''Plane-&amp;amp;gt;Set Contour Parameters''' and '''Strip-&amp;amp;gt;Set Contour Parameters'''. The last base contour level setting will be recalled the next time CARA is started. Spectra transformed with PROSA will usually be scaled so that RMS noise is 100, therefore the common base level for such spectra is 400. Spectra transformed with other software may need a different base level. &lt;br /&gt;
&lt;br /&gt;
Since 3D 13C-resolved NOESY, 3D (H)CCH-COSY and 3D (H)CCH-TOCSY are often recorded with folding in the '''Cinept''' dimension and 15N-resolved NOESY is folded in the 15N dimension, check the '''View-&amp;amp;gt;Show Folded''' box in all windows to allow proper navigation. &lt;br /&gt;
&lt;br /&gt;
By default, spin systems in the '''(select residue)''' pull-down menu of all SystemScope windows are sorted according to spin system number. To sort them according to residue number, uncheck the '''View-&amp;amp;gt;Order by Strip''' box. &lt;br /&gt;
&lt;br /&gt;
In PolyScope windows 3 and 7 check the '''View-&amp;amp;gt;Show List''' to display a panel with a list of spin systems. Click on the '''Assig.''' column header to sort spin systems by residue number. &lt;br /&gt;
&lt;br /&gt;
Since it takes a lot of time to get all windows set up, avoid closing CARA. Fortunately it is quite stable and the Linux version, at least, can stay open for weeks.&lt;br /&gt;
&lt;br /&gt;
== Working with SystemScope ==&lt;br /&gt;
&lt;br /&gt;
To display a strip of interest in a StripScope window, select a residue from the pull-down menu. Spins belonging to the selected spins systems will appear in the panel below it. In the second panel below, a list of &amp;quot;strip anchors&amp;quot; (e.g. CA/HA and CB/HB pairs) will be displayed. Double-click on a spin pair, or right-click and select '''Show Strip'''. A corresponding strip will be displayed to the right. Its dimensions are '''X '''and'''Y''', as defined by the rotation of the spectrum. &lt;br /&gt;
&lt;br /&gt;
If you are opening a 3D 13C-resolved NOESY, 3D (H)CCH-COSY or 3D (H)CCH-TOCSY for the first time, you would want to change the &amp;quot;strip widths&amp;quot; (default is 1 ppm). Right-click on a displayed strip and select '''Set Peak Width'''. Typical values should be 2-3 ppm (13C width in 3D (H)CCH experiments), and 0.3-0.5 ppm (1H width in 3D 13C-resolved NOESY). &lt;br /&gt;
&lt;br /&gt;
If you right-click in the strip panel and select '''Show Depth''', a spectral plane orthogonal to the strip (with dimensions '''Z '''and'''Y''') will be displayed to the right. You may want to zoom the plane out by right-clicking on it an selecting '''Fit window''', or left-clicking in it and using the &amp;lt;tt&amp;gt;ww&amp;lt;/tt&amp;gt; keyboard shortcut. &lt;br /&gt;
&lt;br /&gt;
You can also select a spin in the strip panel and display the orthogonal plane taken at that spin's position by right-clicking and selecting '''Show Orthogonal'''. It is possible to select several spins at once, and thus display more than one plane. &lt;br /&gt;
&lt;br /&gt;
SystemScope in window 5 is used to verify whether diasterotopic spin pairs are degenerate, and pick a missing spin, if not. For example, you have HB/CB of Asn assigned. Display this HB/HB strip in window 5 and use right-click -&amp;amp;gt; '''Show Depth'''. In the depth plane zoom into the region around HB. If HB are non-degenerate and you have missed the other spin, you would see two strong HB2-HB3 peaks both symmetric with respect to diagonal. In addition, the two spin positions should exhibit very similar (though not necessarily identical) NOE peak patterns along Y, including HB-HA and HB-H peaks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
== Validation of HA/CA and HB/CB assignments ==&lt;br /&gt;
&lt;br /&gt;
The first step before you actually pick new side chain spins is to verify that HA/CA assignments are correct and adjust them, if needed.&lt;br /&gt;
&lt;br /&gt;
# In windows 1 ((H)CCH-COSY) and 3 (13C-resolved NOESY) display the HA/CA strip. For Gly residues having two strips, HA2/CA and HA3/CA, repeat for each.&lt;br /&gt;
# Verify that in window 1 you see two peaks in the strip, CA and CB (Gly residues will only have the CA diagonal peak). &lt;br /&gt;
# In window 3 you should see characteristic intra-residue H-HA and HA-HB and sequential HA(i)-H(i+1) NOE peaks.&lt;br /&gt;
# For Gly in window 5 verify whether you have degenerate HA or non-degenerate HA2 and HA3.&lt;br /&gt;
# In the HSQC plane of window 3 move the HA/CA (or HA2/CA and HA3/CA of Gly) peaks so that the NOESY strips are centered.&lt;br /&gt;
# In windows 1 and 3 display the HB/CB strip. Many residues will have two strips, HB2/CB and HB3/CB. &lt;br /&gt;
# Verify that in window 1 you see two or more peaks in the strip - CA, CB and one or two CG peaks for long side chains. &lt;br /&gt;
# In window 3 you should see characteristic intra-residue NOE peaks to HA-HB and, possibly, H-HB.&lt;br /&gt;
# In window 5 verify whether you have degenerate HB or non-degenerate HB2 and HB3.&lt;br /&gt;
# In the HSQC plane of window 3 move the HB/CB (or HB2/CB and HB3/CB) peaks so that the NOESY strips are centered.&lt;br /&gt;
&lt;br /&gt;
Ideally, all CA, CB, HA (or HA2 an HA3), HB (or HB2 and HB3) should be present and their chemical shifts should match (H)CCH-COSY, (H)CCH-TOCSY and 13C-resolved NOESY quite well.&lt;br /&gt;
&lt;br /&gt;
Keep in mind that HA and HB assignments originated from the indirect 1H dimension of 3D HBHA(CO)NH. The direct 1H dimension in (H)CCH-COSY, (H)CCH-TOCSY and 13C-resolved NOESY offers a much higher resolution. Therefore, some HB2 and HB3 spins (or HA2 and HA3 for Gly), which previously were considered degenerate and picked as HB (or HA for Gly), may be resolved in these spectra. If this happens, HB2 and HB3 (or HA2 and HA3) have to be picked separately. For example, you can change the HB label to HB2, and pick HB3 as a new spin.&lt;br /&gt;
&lt;br /&gt;
After validating a few HA/CA and HB/CB chemical shifts you may want to adjust the calibration of 3D (H)CCH-COSY, 3D (H)CCH-TOCSY and 2D [13C, 1H] HSQCs. Since the final chemical shifts are used in 13C-resolved NOESY, calibration of other spectra must be adjusted to match it.&lt;br /&gt;
&lt;br /&gt;
== Common validation issues ==&lt;br /&gt;
&lt;br /&gt;
*Proximity to water resonance&lt;br /&gt;
&lt;br /&gt;
The chemical shift of H2O at 15 &amp;amp;deg;C is about 4.75 ppm. HA resonances of all residue types as well as HB lines of Ser and Thr can be very close to this position. If that happens, either the entire strip may be missing (as water line is often computationally subtracted from the spectrum during processing) or the peaks may be masked by the strong local noise. When the former is true, precise HA position may only be taken from the indirect dimension of the H-N strip of 15N-resolved NOESY or the HB-CB and other strips of the aliphatic 13C-resolved NOESY.&lt;br /&gt;
&lt;br /&gt;
*Missing assignments&lt;br /&gt;
&lt;br /&gt;
For sensitivity-limited samples it is common that some backbone assignments will be missing.&lt;br /&gt;
&lt;br /&gt;
HA, CA and CB assignments present - HB is missing:&lt;br /&gt;
&lt;br /&gt;
# Select the HA/CA strip in 3D (H)CCH-COSY (window 1).&lt;br /&gt;
# Select the CB spin, right-click and select '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HB2 and HB3 (or HB) spins in the orthogonal plane. The correct HB spin position should exhibit CA and CB peaks.&lt;br /&gt;
# Open the new HB2/CB and HB3/CB (or HB/CB) strips in window 3. Verify, that HA-HB (likely H-HB) NOE cross-peaks are present. Adjust the HB/CB positions according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Optionally, verify assignment by checking HA/CA and HB/CB strips in 3D (H)CCH-TOCSY (window 2)&lt;br /&gt;
# Verify the new HB assignments in HBHA(CO)NH (window 7).&lt;br /&gt;
&lt;br /&gt;
HA, CA and HB assignments present - CB is missing:&lt;br /&gt;
&lt;br /&gt;
# Select the HA/CA strip in 3D (H)CCH-COSY (window 1)&lt;br /&gt;
# Pick the CB spin in the strip panel of window 1&lt;br /&gt;
# Select the HB/CB strip(s) in window 1 and use '''Show Depth'''. Verify that CA and CB cross-peaks are present&lt;br /&gt;
# Open the new HB2/CB and HB3/CB (or HB/CB) strips in window 3. Verify, that HA-HB (likely H-HB) NOE cross-peaks are present. Adjust the HB/CB positions according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Optionally, verify assignment by checking HA/CA and HB/CB strips in 3D (H)CCH-TOCSY (window 2).&lt;br /&gt;
# Verify the new CB assignments in HNCACB and CBCA(CO)NH (window 7).&lt;br /&gt;
&lt;br /&gt;
HA and CA are present - CB and HB are missing:&lt;br /&gt;
&lt;br /&gt;
# Select the HA/CA strip in 3D (H)CCH-COSY (window 1).&lt;br /&gt;
# Pick the CB spin in window 1&lt;br /&gt;
# Select the CB spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HB spin(s) in the orthogonal plane. The correct HB spin position should exhibit CA and CB peaks.&lt;br /&gt;
# Open the new HB/CB strip(s) in window 3. Verify, that HA-HB, (possibly H-HB) NOE patterns are present. Adjust the HB/CB position according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Optionally, verify assignment by checking all strips in 3D (H)CCH-TOCSY (window 2)&lt;br /&gt;
# Verify the new CB assignments in HNCACB and CBCA(CO)NH (window 7).&lt;br /&gt;
# Verify the new HB assignments in HBHA(CO)NH (window 7).&lt;br /&gt;
&lt;br /&gt;
HB (or HB2 and HB3) and CB are present - CA and HA are missing:&lt;br /&gt;
&lt;br /&gt;
# Select an HB/CB strip in window 1.&lt;br /&gt;
# Pick the CA spin in window 1.&lt;br /&gt;
# Select the CA spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick the HA spin in the orthogonal plane. The correct HA spin position should exhibit CB and CA peaks.&lt;br /&gt;
# Open the new HA/CA strip in window 3. Verify, that HA-HB and H-HA NOE cross-peaks are present. Adjust the HA/CA position according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Optionally, Verify assignment by checking all strips in 3D (H)CCH-TOCSY&lt;br /&gt;
# Verify the new CA assignments in HNCACB and CBCA(CO)NH (window 7).&lt;br /&gt;
# Verify the new HA assignments in HBHA(CO)NH (window 7).&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
If more spins are missing, and you don't have a starting strip in the (H)CCH-COSY, it is recommended to skip this side-chain. It can be assigned using alternative approaches after all &amp;quot;easy&amp;quot; side chains are assigned.&lt;br /&gt;
&lt;br /&gt;
*Low sensitivity&lt;br /&gt;
&lt;br /&gt;
Certain residues may be exchange-broadened. It is better to skip them first and try to assign them after most of the remaining side chains are assigned.&lt;br /&gt;
&lt;br /&gt;
If you have consistent sensitivity issues with a lot of residues, you probably need to acquire longer (H)CCH and/or NOESY spectra.&lt;br /&gt;
&lt;br /&gt;
*Resonance overlap&lt;br /&gt;
&lt;br /&gt;
Here more attention should be payed to the shape of the peaks and small difference in peak centers between close strips.&lt;br /&gt;
&lt;br /&gt;
*Incorrect assignments&lt;br /&gt;
&lt;br /&gt;
If you don't see the expected patterns in (H)CCH-COSY and 13C-resolved NOESY, and you don't have sensitivity or water resonance issues - then it is likely that the HA/CA and/or HB/CB assignments at a previous stage were incorrect.&lt;br /&gt;
&lt;br /&gt;
See if you are missing peaks in HA/CA strip, HB/CB strip or both. It is unlikely that CA or CB assignment are wrong, since this would have interfered with spin system linking and matching during backbone assignment. &lt;br /&gt;
&lt;br /&gt;
# Find the correct HA or HB by locating the expected pattern in the depth plane (right click -&amp;gt; '''Show Depth'''). Use right-click -&amp;gt; '''Move Orthogonal Spin'''. &lt;br /&gt;
# Pick the alternative location in HBHA(CO)NH or 15N-resolved NOESY&lt;br /&gt;
&lt;br /&gt;
A very common situation is when two spins systems overlap in the H-N plane and, while CA and CB assignments are correct, their HA and HB assignments are inadvertently swapped. Look carefully at the HBHA(CO)NH and HNCA or HNCACB in window 7. Once again, if you cannot fix this problem easily it is better to leave it until most residues are assigned.&lt;br /&gt;
&lt;br /&gt;
== Assignment strategies for individual residue types ==&lt;br /&gt;
&lt;br /&gt;
=== Gly ===&lt;br /&gt;
&lt;br /&gt;
Since technically Gly does not have a side chain, aliphatic assignment is limited to validation of HA2/CA and HA3/CA assignments (or HA/CA, if degenerate).&lt;br /&gt;
&lt;br /&gt;
Validate assignments with 3D 15N-resolved NOESY in window 6. Make sure you observe H-HA2 and H-HA3 intra peaks, as well as HA2(i)-H(i+1) and HA3(i)-H(i+1) sequential peaks.&lt;br /&gt;
&lt;br /&gt;
Note that the chemical shifts of HA2 and HA3 are typically very different. Degenerate HA spins are rare, but not uncommon.&lt;br /&gt;
&lt;br /&gt;
=== Ala, Asn, Asp, Cys, His, Phe, Ser, Trp and Tyr ===&lt;br /&gt;
&lt;br /&gt;
These residues do not have aliphatic H/C moieties beyond HB/CB. Therefore, side-chain assignment is complete after validation of HA/CA and HB/CB assignments.&lt;br /&gt;
&lt;br /&gt;
Validate assignments with 3D 15N-resolved NOESY in window 6. Make sure you observe H-HA and H-HB intra peaks, as well as HA(i)-H(i+1) and, possibly, HB(i)-H(i+1) sequential peaks.&lt;br /&gt;
&lt;br /&gt;
Note that the chemical shifts of HB2 and HB3 of Phe and Tyr (and to a lesser extent of His and Trp) are frequently very different. &lt;br /&gt;
&lt;br /&gt;
It may happen that CA and CB chemical shifts overlap in Ser. Thus the expected patterns in (H)CCH-COSY and (H)CCH-TOCSY will be absent. The same is also true for Thr.&lt;br /&gt;
&lt;br /&gt;
=== Gln, Glu and Met ===&lt;br /&gt;
&lt;br /&gt;
For these residues you need to assign HG2/CG and HG3/CG (or HG/CG, if degenerate). Follow this procedure:&lt;br /&gt;
&lt;br /&gt;
# Select an HB/CB strip in window 1&lt;br /&gt;
# Pick CG spin(s) in window 1&lt;br /&gt;
# Select a CG spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HG spin(s) in the orthogonal plane. The correct HG spin position should exhibit CB and CG peaks.&lt;br /&gt;
# Open the new HG/CG strip(s) in window 3. Verify, that HA-HG, HB-HG (possibly H-HG) NOE patterns are present. Adjust the HG/CG position according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# In window 5 verify whether HG assignments are degenerate.&lt;br /&gt;
# Verify assignment by checking all strips in 3D (H)CCH-TOCSY.&lt;br /&gt;
# Validate assignments with 3D 15N-resolved NOESY in window 6. Make sure you observe H-HA and H-HB, possibly H-HG intra peaks, as well as HA(i)-H(i+1) and, possibly, HB(i)-H(i+1) and HG(i)-H(i+1) sequential peaks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The assignment can be complicated by the fact that these residues have very low chemical shift dispersion of HB/CB and HG/CG pairs. It is common for HB/CB and HG/CG peaks from several Gln and Glu residues in a protein to form a single blob. In addition, HB and HG chemical shifts within a single residue are usually very similar.&lt;br /&gt;
&lt;br /&gt;
If you cannot reliably pick the CG spin in HB/CB strip of 3D (H)CCH-COSY (due to overlap, for example), try locating it in the HA/CA 3D (H)CCH-TOCSY.&lt;br /&gt;
&lt;br /&gt;
If that fails, try the alternative approach: &lt;br /&gt;
# Locate HG candidates in the HB/CB and HA/CA strips of aliphatic 3D C13-resolved NOESY (window 3), or H/N strip of 3D N15-resolved NOESY (window 5).&lt;br /&gt;
# In window 4 select an HG candidate and use '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# In the orthogonal plane locate the CG candidate. The correct CG position should exhibit HG-HB, HG-HA, possibly HG-H NOE cross-peaks. If there are no good CG choices, repeat from step 2 with the next HG candidate.&lt;br /&gt;
# Validate and adjust positions of HG/CG strip in window 3.&lt;br /&gt;
&lt;br /&gt;
The HE/CE methyl group of Met is assigned at later stage.&lt;br /&gt;
&lt;br /&gt;
=== Arg and Pro ===&lt;br /&gt;
&lt;br /&gt;
For these residues you need to assign HG2/CG, HG3/CG (or HG/CG, if degenerate), HD2/CD and HD3/CD (or HD/CD, if degenerate). &lt;br /&gt;
&lt;br /&gt;
HG/CG should be assigned in the same manner as Glu, Gln and Met. For HD/CD follow this procedure:&lt;br /&gt;
&lt;br /&gt;
# Select an HG/CG strip in window 1.&lt;br /&gt;
# Pick CD spin(s) in window 1.&lt;br /&gt;
# Select a CD spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HD spin(s) in the orthogonal plane. The correct HD spin position should exhibit CG and CD peaks&lt;br /&gt;
# Open the new HD/CD strip(s) in window 3. Verify, that HG-HD NOE patterns are present. Adjust the HD/CD position according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Verify HD assignments in window 5.&lt;br /&gt;
# Verify assignment by checking all strips in 3D (H)CCH-TOCSY (window 2).&lt;br /&gt;
## For Arg, validate assignments with 3D 15N-resolved NOESY in window 6. Make sure you observe H-HA and H-HB, possibly H-HG intra peaks, as well as HA(i)-H(i+1) and, possibly, HB(i)-H(i+1) and HG(i)-H(i+1) sequential peaks.&lt;br /&gt;
## For Pro, validate assignments with 3D 15N-resolved NOESY in window 6. Make sure you observe HA(i)-H(i+1) and, possibly, HB(i)-H(i+1) sequential peaks. In window 3, verify that you observe HA(i-1)-HD2(i) and HA(i-1)-HD3(i) sequential NOE peaks for ''trans'' Xxx-Pro bond, or HA(i-1)-HA(i) sequential NOE peaks for ''cis'' Xxx-Pro bond.&lt;br /&gt;
&lt;br /&gt;
Pro residues rarely have degenerate HB, HG or HD, though sometimes they happen. HD2/CD and HD3/CD cross-peaks can be guessed from 2D aliphatic [13C, 1H] HSQC, as they exclusively occupy a distinct region around (3.6 ppm, 50 ppm). HD2 and HD3 of a particular Pro residue can be picked from HA(i-1)-HD2(i) and HA(i-1)-HD3(i) NOE crosspeaks off the HA of a previous residue (this is true only for the most common ''trans'' Xxx-Pro bond, for rare ''cis'' Xxx-Pro peptide bonds these peaks are absent). The side-chain assignment can then proceed &amp;quot;backwards&amp;quot; toward HA/CA.&lt;br /&gt;
&lt;br /&gt;
In both Arg and Pro HG can overlap with HB.&lt;br /&gt;
&lt;br /&gt;
=== Lys ===&lt;br /&gt;
&lt;br /&gt;
For Lys you need to assign HG2/CG, HG3/CG (or HG/CG), HD2/CD and HD3/CD (or HD/CD), and HE2/CE and HE3/CE (or HE/CE)&lt;br /&gt;
&lt;br /&gt;
HG/CG and HD/CD are assigned in the same manner as Arg and Pro. For HE/CE follow this procedure:&lt;br /&gt;
&lt;br /&gt;
# Select an HD/CD strip in window 1.&lt;br /&gt;
# Pick CE spin(s) in window 1.&lt;br /&gt;
# Select a CE spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HE spin(s) in the orthogonal plane. The correct HE spin position should exhibit CD and CE peaks.&lt;br /&gt;
# Open the new HE/CE strip(s) in window 3*. Verify, that HD-HE NOE patterns are present. Adjust the HE/CE position according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# In window 5 verify whether HE2 and HE3 are degenerate.&lt;br /&gt;
# Verify assignment by checking all strips in 3D (H)CCH-TOCSY.&lt;br /&gt;
# Validate assignments with 3D 15N-resolved NOESY in window 6. Make sure you observe H-HA and H-HB, possibly H-HG intra peaks, as well as HA(i)-H(i+1) and, possibly, HB(i)-H(i+1) and HG(i)-H(i+1) sequential peaks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Chemical shifts of HB, HG and HD of Lys are typically very similar, which complicates validation with 13C-resolved NOESY. For example, the HG-HD cross-peaks are often very close to the diagonal. In addition to that, Lys residues are frequently located on the protein surface and their side-chains exhibit only intra-residue NOEs. Thus, HD assignments can often only be validated through the HD-HE cross-peaks, since HE have distinct chemical shifts.&lt;br /&gt;
&lt;br /&gt;
Also, HE/CE pairs of different Lys residues tend to be very close together, and cannot be told apart in 2D [13C, 1H] HSQC.&lt;br /&gt;
&lt;br /&gt;
=== Thr ===&lt;br /&gt;
&lt;br /&gt;
Thr can be assigned according to procedure for Glu, Gln and Met, though Thr only has one HG2, and the carbon is labeled CG2 (not CG).&lt;br /&gt;
&lt;br /&gt;
Thr is the only residue whose HB can be found either upfield or downfield of HA - it can also overlap with HA. Both can be in proximity to the water resonance, complicating assignment.&lt;br /&gt;
&lt;br /&gt;
It may happen that CA and CB chemical shifts overlap in Thr. Thus the expected patterns in (H)CCH-COSY and (H)CCH-TOCSY will be absent. The same is also true for Ser.&lt;br /&gt;
&lt;br /&gt;
=== Val ===&lt;br /&gt;
&lt;br /&gt;
For Val you have to assign both HG1/CG1 and HG2/CG2 methyl groups.&lt;br /&gt;
&lt;br /&gt;
# Select the HB/CB strip in window 1.&lt;br /&gt;
# Pick CG1 and CG2 spins in window 1. If only one peak is visible, pick it as CG1 (for compatibility with CYANA).&lt;br /&gt;
# Select CG1 spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HG1 spin in the orthogonal plane. The correct HG1 spin position should exhibit CB and CG1 peaks.&lt;br /&gt;
# Select CG2 spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HG2 spin in the orthogonal plane. The correct HG2 spin position should exhibit CB and CG2 peaks.&lt;br /&gt;
# Open the new HG1/CG1 strip in window 3. Verify, that HA-HG1, HB-HG1, HG2-HG1 (possibly H-HG) NOE patterns are present. Adjust the HG1/CG1 position according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Repeat the last step for the HG2/CG2 pair.&lt;br /&gt;
# Verify assignment by checking all strips in 3D (H)CCH-TOCSY&lt;br /&gt;
# Validate assignments with 3D 15N-resolved NOESY in window 6. Make sure you observe H-HA, H-HB, H-HG1 and H-HG2 intra peaks, as well as HA(i)-H(i+1) and, possibly, HB(i)-H(i+1), HG1(i)-H(i+1), HG2(i)-H(i+1) sequential peaks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
There may be difficult cases when only one CG peak is visible instead of two. There are two possibilities:&lt;br /&gt;
* It is very rare that both CG1/CG2 and HG1/HG2 spins are degenerate. One can tell that this is the case if there is only one HG candidate in the orthogonal plane. Only two spins should be assigned - CG1 and HG (note that CG label is not compatible with CYANA and should not be used).&lt;br /&gt;
* A more common occurrence is when only CG1/CG2 are degenerate and HG1/HG2 are not. If this is the case, the orthogonal plane for CG1 and CG2 will apparently contain two valid HG1 and HG2 candidates. Four spins (CG1, CG2, HG1 and HG2) should be picked even though CG1 and CG2 shifts may be identical. The methyl groups can be later distinguished for stereospecific assignment.&lt;br /&gt;
&lt;br /&gt;
Another issue may be the degeneracy of HG1 and HG2, when CG1/CG2 are not degenerate. In this case, too, four spins (CG1, CG2, HG1 and HG2) should be picked.&lt;br /&gt;
&lt;br /&gt;
=== Leu ===&lt;br /&gt;
&lt;br /&gt;
For Leu you need to assign HG/CG, HD1/CD1 and HD2/CD2 groups.&lt;br /&gt;
&lt;br /&gt;
# Select an HB/CB strip in window 1.&lt;br /&gt;
# Pick CG spin in window 1.&lt;br /&gt;
# Select the CG spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HG spin in the orthogonal plane. The correct HG spin position should exhibit CB and CG peaks (plus unassigned CD1 and CD2 peaks).&lt;br /&gt;
# Open the new HG/CG strip in window 3. Verify, that HB-HG (possibly HB-HG and H-HG) NOE patterns are present. Adjust the HG/CG position according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Select the HG/CG strip in window 1.&lt;br /&gt;
# Pick CD1 and CD2 spins in window 1. If only one peak is visible, pick it as CD1 (for compatibility with CYANA).&lt;br /&gt;
# Select CD1 spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HD1 spin in the orthogonal plane. The correct HD1 spin position should exhibit CG and CD1 peaks.&lt;br /&gt;
# Select CD2 spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HD2 spin in the orthogonal plane. The correct HD2 spin position should exhibit CG and CD2 peaks.&lt;br /&gt;
# Open the new HD1/CD1 strip in window 3. Verify that HB-HD1, HG-HD1, HD2-HD1 (possibly HA-HD1) NOE patterns are present. Adjust the HD1/CD1 position according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Repeat the last step for the HD2/CD2 pair.&lt;br /&gt;
# Verify assignment by checking all strips in 3D (H)CCH-TOCSY&lt;br /&gt;
# Validate assignments with 3D 15N-resolved NOESY in window 6. Make sure you observe H-HA, H-HB, possibly H-HG, H-HD1 and H-HD2 intra peaks, as well as HA(i)-H(i+1) and, possibly, HB(i)-H(i+1), HG(i)-H(i+1), HD1(i)-H(i+1), HD2(i)-H(i+1) sequential peaks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
There my be degeneracy issues with HD1, HD2, CD1 and CD2 spins, which are the same as those of HG1, HG2, CG1 and CG2 spins of Val above.&lt;br /&gt;
&lt;br /&gt;
Additional problem could be the overlap of CG and CD1 (or, equivalently, CG and CD2). In this case the orthogonal plane should contain both HG and HD1 (or HG and HD2) candidates, which typically have distinct chemical shifts.&lt;br /&gt;
&lt;br /&gt;
Another issue is low intensity of the HG/CG strip, which often complicates HG assignment. An additional hindrance is that HG often overlaps with HB2 or HB3. To overcome this, you can hop over to CD1 and CD2 by picking them from HB2/CB and HB3/CB strips in 3D (H)CCH-TOCSY. HG can the picked using the alternative approached by looking for HG-HD1 and HG-HD2 cross-peaks in 13C-resolved NOESY.&lt;br /&gt;
&lt;br /&gt;
Note that HB2 and HB3 are seldom degenerate in Leu.&lt;br /&gt;
&lt;br /&gt;
=== Ile ===&lt;br /&gt;
&lt;br /&gt;
Despite the complexity of its branched side-chain, Ile is probably the easiest to assign due to all its aliphatic 13C and 1H spins having distinct chemical shifts.&lt;br /&gt;
&lt;br /&gt;
In Ile you have to assign HG12/CG, HG13/CG, HG2/CG2 and HD1/CD1 spins&lt;br /&gt;
&lt;br /&gt;
# Select the HB/CB strip in window 1.&lt;br /&gt;
# Pick CG1 and CG2 spins in window 1.&lt;br /&gt;
# Select the CG2 spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick the HG2 spin in the orthogonal plane. The correct HG2 spin position should exhibit only CB and CG2 peaks.&lt;br /&gt;
# Open the new HG2/CG2 strip in window 3. Verify, that HB-HG2, HA-HG2 (possibly H-HG) NOE patterns are present. Adjust the HG2/CG2 positions according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Select the CG1 spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HG12 and HG13 spins in the orthogonal plane. The correct HG12 and HG13 spin positions should exhibit CB and CG1 peaks (plus unassigned CD1 peak).&lt;br /&gt;
# Open the new HG12/CG1 and HG13/CG1 strips in window 3. Verify that HB-HG12, HB-HG13, HG2-HG12, HG2-HG13 (possibly HA-HG12, HA-HG13, H-HG12 and H-HG13) NOE peaks are present. Adjust the HG12/CG1  and HG13/CG1 positions according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Verify HG12 and HG13 assignments in window 5&lt;br /&gt;
# Select HG12/CG1 or HG13/CG1 strip in window 5.&lt;br /&gt;
# Pick the CD1 spin in window 1.&lt;br /&gt;
# Select the CD1 spin and right-click, then '''Show Orthogonal''' to display the orthogonal plane.&lt;br /&gt;
# Pick HD1 spin in the orthogonal plane. The correct HD1 spin position should exhibit CG and CD1 peaks.&lt;br /&gt;
# Open the new HD1/CD1 strip in window 3. Verify that HB-HD1, HG12-HD1, HG13-HD1, HG2-HD1 (possibly HA-HD1) NOE patterns are present. Adjust the HD1/CD1 position according to aliphatic 13C-resolved NOESY.&lt;br /&gt;
# Verify assignment by checking all strips in 3D (H)CCH-TOCSY&lt;br /&gt;
# Validate assignments with 3D 15N-resolved NOESY in window 6. Make sure you observe H-HA, H-HB, H-HG2, possibly H-HG12, H-HG13 and H-HD1 intra peaks, as well as HA(i)-H(i+1) and, possibly, HB(i)-H(i+1), HG12(i)-H(i+1), HG13(i)-H(i+1), HG2(i)-H(i+1), HD1(i)-H(i+1) sequential peaks.&lt;br /&gt;
&lt;br /&gt;
It is exceptionally rare for Ile to have degenerate HG12 and HG13 shifts. On the contrary, they are normally very far apart. Therefore, make sure that you don't miss one of them by zooming in too closely on a spectrum.&lt;br /&gt;
&lt;br /&gt;
HB can overlap with either HG12 or HG13&lt;br /&gt;
&lt;br /&gt;
== Filling in the gaps ==&lt;br /&gt;
&lt;br /&gt;
After the first pass through the sequence some residues were skipped. You may also have small gaps in the backbone assignment.&lt;br /&gt;
&lt;br /&gt;
One category of skipped residues are those directly preceding prolines, since they will have CA and CB assignments at most. According to the alternative approach you have to find HA and HB in the H strip is the same residue in 15N-resolved NOESY (windows 6 and 7) and in the HD2 and HD3 strips of the succeeding Pro in 13C-resolved NOESY (window 3). Note that the latter is only valid for ''trans'' peptide bond. You should consider looking at the HA strip of Pro, if you don't see any candidates in HD2 and HD3 strips.&lt;br /&gt;
&lt;br /&gt;
-- Main.AlexEletski - 09 Mar 2007&lt;/div&gt;</summary>
		<author><name>Xianzhon</name></author>
	</entry>
</feed>