Resonance Assignment/Abacus/Protein Sequence format - Revision history

Agutmana: moved Protein Sequence format to Resonance Assignment/Abacus/Protein Sequence format

2010-01-05T23:34:17Z

← Older revision	Revision as of 23:34, 5 January 2010
(No difference)

2009-12-15T21:14:44Z

← Older revision		Revision as of 21:14, 15 December 2009
Line 16:		Line 16:
	== <br>'''2. "Standard" format.''' ==		== <br>'''2. "Standard" format.''' ==

	Each line contains name of one residue in 3-~~lettr~~ code and, optionally, the residue ID.		Each line contains name of one residue in 3-letter code and, optionally, the residue ID.

	(Only residue ID of the first residue is used to start [[FMCGUI objects#Protein_sequence\|numbering of sequence positions]].		(Only residue ID of the first residue is used to start [[FMCGUI objects#Protein_sequence\|numbering of sequence positions]].

	<br>		<br>

2009-12-15T21:14:24Z

← Older revision		Revision as of 21:14, 15 December 2009
Line 3:		Line 3:
	== '''1. Fasta format.''' ==		== '''1. Fasta format.''' ==

	The first line ~~shoul~~ start with '>' symbol.		The first line should start with '>' symbol.

	Next one or more lines contain sequence in 1-letter code.		Next one or more lines contain sequence in 1-letter code.

	<br>		<br>

	''Example 1.1:<br>''		''Example 1.1:<br>''
	<pre>>		<pre>>
	MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTE		MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTE
	KLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKD </pre>		KLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKD </pre>

	== <br>'''2. "Standard" format.''' ==		== <br>'''2. "Standard" format.''' ==

2009-12-01T16:58:13Z

← Older revision	Revision as of 16:58, 1 December 2009
(No difference)

2009-11-30T23:08:06Z

← Older revision		Revision as of 23:08, 30 November 2009
Line 17:		Line 17:
	Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.		Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.

	(Only residue ID of the first residue ~~of the~~ [[FMCGUI objects#Protein_sequence\|~~sequence]] is used to start~~ numbering of ~~the~~ sequence positions).		(Only residue ID of the first residue is used to start [[FMCGUI objects#Protein_sequence\|numbering of sequence positions]].

	<br>		<br>

2009-11-30T23:05:44Z

← Older revision		Revision as of 23:05, 30 November 2009
Line 17:		Line 17:
	Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.		Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.

	(Only residue ID of the first residue of the [[~~FMCGUI_objects~~#~~Protein_Sequence~~\|sequence]] is used to start numbering of the sequence positions).		(Only residue ID of the first residue of the [[FMCGUI objects#Protein_sequence\|sequence]] is used to start numbering of the sequence positions).

	<br>		<br>

2009-11-30T23:05:21Z

← Older revision		Revision as of 23:05, 30 November 2009
Line 17:		Line 17:
	Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.		Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.

	(~~only~~ residue ID of the first residue is used to start numbering of the sequence positions).		(Only residue ID of the first residue of the [[FMCGUI_objects#Protein_Sequence\|sequence]] is used to start numbering of the sequence positions).

	<br>		<br>

	''Example 2.1.'' (position ID is not specified):		''Example 2.1.'' (position ID is not specified):
Line 33:		Line 33:
	GLU		GLU
	GLY		GLY
	.... </pre>		.... </pre>
	''Example 2.2.'' (with specified all position ID):		''Example 2.2.'' (with specified all position ID):
	<pre>GLN -3		<pre>GLN -3
Line 44:		Line 44:
	ILE 4		ILE 4
	TYR 5		TYR 5
	..... </pre>		..... </pre>
	''Example 2.3.'' (with specified first position ID):		''Example 2.3.'' (with specified first position ID):
	<pre>GLN -3		<pre>GLN -3

2009-11-27T20:25:21Z

2009-11-27T20:19:56Z

← Older revision		Revision as of 20:19, 27 November 2009
Line 1:		Line 1:
	= '''1. Fasta format.''' =		== '''1. Fasta format.''' ==

	The first line shoul start with '>' symbol.		The first line shoul start with '>' symbol.
Line 11:		Line 11:
	MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTE		MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTE
	KLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKD </pre>		KLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKD </pre>
	= <br>'''2. "Standard" format.''' =		== <br>'''2. "Standard" format.''' ==

	Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.		Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.

2009-11-26T23:31:16Z

← Older revision		Revision as of 23:31, 26 November 2009
Line 1:		Line 1:
	'''1. Fasta format.'''		= '''1. Fasta format.''' =

	The first line shoul start with '>' symbol.		The first line shoul start with '>' symbol.
Line 7:		Line 7:
	<br>		<br>

	''Example 1:<br>''		''Example 1.1:<br>''
	<pre>>		<pre>>
	MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTE		MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTE
	KLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKD </pre>		KLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKD </pre>
	<br>'''2. "Standard" format.'''		= <br>'''2. "Standard" format.''' =

	Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.		Each line contains name of one residue in 3-lettr code and, optionally, the residue ID.
Line 19:		Line 19:
	<br>		<br>

	''Example 2.1'' (position ID is not specified):		''Example 2.1.'' (position ID is not specified):
	<pre>GLN		<pre>GLN
	GLY		GLY
Line 32:		Line 32:
	GLY		GLY
	.... </pre>		.... </pre>
	''Example 2.2'' (with specified all position ID):		''Example 2.2.'' (with specified all position ID):
	<pre>GLN -3		<pre>GLN -3
	GLY -2		GLY -2
Line 43:		Line 43:
	TYR 5		TYR 5
	..... </pre>		..... </pre>
	''Example 2.3'' (with specified first position ID):		''Example 2.3.'' (with specified first position ID):
	<pre>GLN -3		<pre>GLN -3
	GLY		GLY